- DL manuals
- 3M
- Monitor
- Dynapro ET TCS
- Application Developer's Manual
3M Dynapro ET TCS Application Developer's Manual - page 298
B-22
7DEOH%6XPPDU\RI7&6&RPPDQGV*URXSHG$FFRUGLQJWR5HODWHG)XQFWLRQV
FRQWLQXHG
&200$1'01(021,&
+26786$*(7&65(63216(
5HPRWH6HOI7HVW&RPPDQGV
7&65HVSRQVH
FRQWLQXHG
'HFLPDOHTXLYDOHQWRIWKHODVWIDLOHGDGGUHVV,IQRHUURUVZHUHGHWHFWHG
3HUURU!
'HFLPDOHTXLYDOHQWRIWKHGDWDYDOXHVHQWWRWKHODVWIDLOHGDGGUHVV
H[FOXVLYH25HGZLWKWKHGDWDYDOXHUHFHLYHGDWWKHODVWIDLOHGDGGUHVV
3KLVWRU\!
'HFLPDOHTXLYDOHQWRIWKHGDWDELWHUURUKLVWRU\DELWZRUGWKDWFRQWDLQV
DORJLFLQHDFKELWSRVLWLRQWKDWKDVQHYHUVKRZQDQHUURUGXULQJDOO5$0
WHVWLQJFRQWDLQVDORJLFLQDQ\ELWSRVLWLRQWKDWKDVFRQWDLQHGDQHUURU
GXULQJ5$0WHVWLQJ
5HTXHVW7RXFK3DQHO7HVW5HSRUW
^)5775`
(6&!>!Q
7&65HVSRQVH
(6&!>!3ORRSV!3IDLO!3HUURU!Q
3ORRSV!
1XPEHURIWRXFKSDQHOWHVWVFRPSOHWHGVLQFHWKH&RQWLQXRXV,QWHJULW\7HVW
VWDUWHGRUVLQFHODVWSRZHUXSRUUHVHW
3IDLO!
1XPEHURIWRXFKSDQHOWHVWVGHWHFWLQJDIDLOXUHVLQFHWKH&RQWLQXRXV
,QWHJULW\7HVWZDVVWDUWHGRUODVWSRZHUXSRUUHVHW
3HUURU!
'HFLPDOHTXLYDOHQWRIWKHPRVWUHFHQWWRXFKFHOOFORVXUH
Summary of Dynapro ET TCS
Page 2
&rs\uljkw,qirupdwlrq this manual is © 1994 dynapro technologies inc. All rights reserved. Reproduction of the contents of this copyrighted manual in whole or in part, by any means, electronic or mechanical, for any purpose, without written permission of dynapro technologies inc., is prohibited. ,psr...
Page 3
(ujr7rxfk7&6'rfxphqwdwlrq8sgdwhv 8sgdwh'xdo6fdq3dvvlyh'63&roru/&' this amends the information supplied in the ergotouch tcs installation guide, second edition, december 1994. This information was originally published as document 80-0437. Ergotouch’s dsp display has been enhanced. Specifications for ...
Page 4: 7Deohri&rqwhqwv
7deohri&rqwhqwv chapter 1 general information.......................................................................................... 1-1 overview ............................................................................................................................................... 1-1 fea...
Page 5
Color tcs: summary of color programming.................................................................... 3-24 displaying and erasing color characteristics .................................................................................... 3-24 highlighting color characters .........................
Page 6
Overview of screen memory ....................................................................................................... 5-5 introduction ............................................................................................................................................ 5-5 referrin...
Page 7
Read cursor position command [cpr] (remote)................................................................................ 5-93 read character under cursor command {frcuc} (remote) ........................................................... 5-94 read attributes under cursor command {frauc} (remote)...
Page 8
Keyboard commands ....................................................................................................................... 7-8 keyboard lockout mode command [kam] (remote)........................................................................... 7-9 keypad mode command [deckpam] [dec...
Page 9
Appendix d in case of difficulty ......................................................................................... D-1 introduction ..................................................................................................................................... D-1 symptom/solution chart...
Page 10: /lvwri7Deohv
/lvwri7deohv table 2-1. Framing formats ........................................................................................................ 2-2 table 2-2. Touch control screen parity settings ......................................................................... 2-4 table 3-1. Control codes ...
Page 11
Table 7-5. Auxiliary keypad codes ............................................................................................. 7-7 table b-1. Summary of tcs commands grouped according to related functions ................. B-2 table c-1. Static ascii character font.....................................
Page 12: /lvwri)Ljxuhv
/lvwri)ljxuhv figure 2-1. Typical asynchronous framing format .................................................................... 2-3 figure 4-1. Sample communication monitor screen................................................................. 4-34 figure 5-1. Codes access the character sets ......
Page 13: &+$37(5*(1(5$/,1)250$7,21
1-1 &+$37(5*(1(5$/,1)250$7,21 29(59,(: the touch control screen (tcs) is a sophisticated interface between human operators and computer-driven systems. The tcs allows the operator, with a minimum of training, to accurately and efficiently control complex operations by touching the screen. The touch ...
Page 14
1-2 +dugzduh • integral touch panel with a 120 touch cell matrix (12 rows by 10 columns) • keyboard port with adapter cable for connection to a standard pc-at keyboard • high contrast electroluminescent (el) or dual scan passive (dsp) color display that can display 1920 characters (24 lines of 80 ch...
Page 15: ,1752'8&7,21
2-1 &+$37(5,17(5)$&,1*727+(+267&20387(5 ,1752'8&7,21 this chapter provides information about communication between the touch control screen (tcs) and host computer. Topics include: • a description of serial data • electronics industries association (eia) standards rs-232-e, rs-422-a, and rs-485 • tc...
Page 16
2-2 7lplqj)rupdw serial data can be transmitted in either a synchronous or asynchronous timing format. In a synchronous format, individual codes in the message are synchronized to a clock signal and sent one after another, without any special bits separating them. Start and stop codes mark the begin...
Page 17
2-3 ,goh 6wrs %lwv ,goh 6wduw %lw 2swlrqdo 3dulw\ %lw 'dwd %lwv )ljxuh7\slfdo$v\qfkurqrxv)udplqj)rupdw note in figure 2-1, indicates a space (logical zero) and indicates a mark (logical one). However, on the rs-232 line itself these are inverted, so a mark is a low voltage and a space is a high volt...
Page 18
2-4 by setting two tcs parameters (parity enable and parity sense), the parity bit can be used in five ways, as shown in table 2-2. Instructions for setting the parity enable and parity sense parameters are provided in the installation guide, under using the setup screen..
Page 19
2-5 7deoh7rxfk&rqwuro6fuhhq3dulw\6hwwlqjv 3$5,7 6(77,1* 3$5,7 6(77,1* ())(&7 2ii (yhqrurgg 3dulw\fkhfnlqjdqgjhqhudwlrqduhglvdeohg7kh7&6grhvqrw wudqvplwdsdulw\elwdqggrhvqrwh[shfwsdulw\elwvlqwkhgdwdlw uhfhlyhv,iwkh7&6uhfhlyhvgdwdfrqwdlqlqjdsdulw\elwwkhgdwdlv glvsod\hgdvdiudplqjhuuru )( 2q (yhq 3dulw\f...
Page 20
2-6 &rppxqlfdwlrq6wdqgdugv the tcs adheres to three widely used electronics industries association (eia) standards: rs-232-e, rs-422-a, and rs-485. Rs-232-e is the most widely accepted standard for digital data communication; few pieces of computer-related equipment are supplied without an rs-232- e...
Page 21
2-7 56(6wdqgdug the rs-232-e standard defines the electrical and mechanical characteristics of an interface between data terminal equipment (dte) and data communication equipment (dce) that uses serial binary data interchange. Note the tcs is data terminal equipment (dte) as described by the rs-232-...
Page 22
2-8 • request to send (ca) (output) in the tcs, request to send (rts) is always on immediately after the power-up sequence and self-tests have finished executing. Rts remains on except during a reset, a long break, or if the power to the tcs is switched off. Note this use of request to send complies...
Page 23
2-9 56dqg56 the unbalanced interface defined by the rs-232-e standard is suitable for many installations. But for installations requiring increased line lengths, especially at high data rates, problems begin to emerge. It becomes difficult to distinguish between valid data signals and noise due to g...
Page 24
2-10 3uhyhqwlqjdqg'hwhfwlqj(uuruv because communication with the host computer occurs over a serial hardware link, noisy or faulty connections can possibly corrupt the data stream and introduce errors. The tcs uses techniques to minimize the possible effects of several types of communication errors....
Page 25
2-11 regardless of the state of the xon/xoff mode, the tcs can stall and unstall the host only after two-way communication of control codes is established. Two-way communication of control codes occurs when multidrop operation is disabled, multidrop is enabled and tcs is addressed individually, or w...
Page 26
2-12 • when the tcs address is changed from rs232 or rs485 to a multidrop address and the host has been stalled. • the tcs address is changed to rs232 or rs485, the tcs was not addressed for two-way communication, and the input buffer is less than 75% full. When xon/xoff mode is on, the user can man...
Page 27: &+$37(5352*5$00,1*29(59,(:
3-1 &+$37(5352*5$00,1*29(59,(: ,1752'8&7,21 this chapter provides a general overview of touch control screen (tcs) programming. Topics include: • coding standards • communication environments • communication codes • character sets • tcs commands • a general description of control strings • how to ge...
Page 28: &20081,&$7,21(19,5210(176
3-2 &20081,&$7,21(19,5210(176 the tcs can communicate with the host using either 7 or 8 data bits. The number of data bits is selected by setting the data bits parameter in the setup screen. (see the data bits command in chapter 4.) when the tcs is set for 7-bit communication, the tcs sends and rece...
Page 29
3-3 of the 66 control codes reserved by ansi, the tcs acts upon those listed in table 3-1. Any other control codes received by the tcs are ignored (except as described later in this chapter under the heading, errors in control strings). 7deoh&rqwuro&rghv5hfrjql]hge\wkh7&6 01(021,& +(;9$/8( 1$0( $&7,...
Page 30
3-4 )227127(6 7khvhfrqwurofrghvduhljqruhgliwkh0xowlgurs$gguhvvriwkh7&6lvvhwwrqrqh $owkrxjkwklvfrghirupvsduwriwkhpxowlgurssurwrfrozkhqwudqvplwwhge\wkh7&6lwlvljqruhgzkhq uhfhlyhg (dfk%(/!Zloovrxqgrqhehoozkhqvhqwwrwkh'lvsod\hg6fuhhq,id%(/!Lvuhfhlyhgzklohdvwruhg vfuhhqlvvhohfwhgqrdxgleohehoozloovrxqg +r...
Page 31: 7&6&200$1'6
3-5 characters in either character set corresponding to control codes cannot be directly displayed. These characters must be displayed by other means, as described previously in this chapter under the heading, control codes. See chapter 5 for additional information about using graphic codes to displ...
Page 32
3-6 1n addition to these actions, the user can cause the tcs to send codes to the host by pressing the touch panel or typing on the keyboard. However, these actions are not referred to as local commands. 5hprwh&rppdqgv remote commands are those sent by the host to the tcs over the serial interface. ...
Page 33: &21752/675,1*6
3-7 &21752/675,1*6 an ansi standard control string is a remote command that consists of a special sequence of two or more codes starting with the escape code , the control sequence introducer code , or the device control string code . Control strings provide the host with commands that control the t...
Page 34
3-8 &rqwuro6htxhqfhv the general format for a control sequence is: [;;...; or ;;...; where: [ = control sequence introducer = control sequence introducer = optional private command code (?>) = first optional parameter = second optional parameter = last optional parameter = final code a control seque...
Page 35
3-9 &rqwuro6htxhqfh3dudphwhuv a control sequence parameter is a string of the codes representing 0 through 9. The tcs interprets the string of digits as a decimal number. Leading zeros are ignored. If a control sequence contains more than one parameter, the parameters must be separated by semicolons...
Page 36
3-10 the command is ignored because the parameter designating the bottom line of the scrolling region (4) is less than or equal to the parameter designating the top line (22). Numeric parameters outside the valid range are ignored or limited within a reasonable range, as specified in the detailed de...
Page 37
3-11 2. Command lookup the tcs looks up a command using the combination of the control sequence’s private command code, the final code, and possibly the first parameter. The tcs does not have a command for every possible control sequence combination. If the tcs has a corresponding command, the tcs a...
Page 38: +2:72*(1(5$7(5(027(&200$1'6
3-12 +2:72*(1(5$7(5(027(&200$1'6 how remote commands are sent from the host computer to the tcs depends entirely on the specific host computer and application software. Different computers and application programs can handle rs-232-e, i/o (input/output) communication differently. The following examp...
Page 39: 67$7865(32576800$5
3-13 67$7865(32576800$5 the host can query the tcs for a wide range of status reports. The status reports allow the host to read the contents and attributes of the tcs display, sense touch call closures, and verify that the tcs is operating properly. 6xppdu\ri6wdwxv4xhulhvdqg5hvsrqvhv the host can q...
Page 40
3-14 7deoh6xppdu\ri6wdwxv4xhulhvdqg5hsruwv +267&200$1' 7&65(63216( 0($1,1* (6&!>f 5htxhvw7&67\sh&rppdqg (6&!>3w!3y! 3p!3g!3z! 3r!F 7&6w\shuhsruw3w!Lviruiru3y!Lvilupzduh yhuvlrqpqq yhuvlrqpqq3p!Lvwkhdprxqwlqe\whvri ([sdqvlrq0hpru\3g! 3z! Dqg3r!Lvuhvhuyhg iruodwhuxvh (6&!>q 5htxhvw7&66wdwxvfrppdqg 5ht...
Page 41
3-15 7deoh6xppdu\ri6wdwxv4xhulhvdqg5hsruwv frqwlqxhg +267&200$1' 7&65(63216( 0($1,1* (6&!>!Q 5hdg$wwulexwhv8qghu&xuvrufrppdqg5htxhvwvfkdudfwhu dwwulexwhvdwfxuuhqwfxuvrusrvlwlrq (6&!>!3kl! 3xo!3eolqn!3uy! 3f!Q (6&!>!3kl! 3xo!3eolqn!3uy! 3f!3ij!3ej! 3ff!Q 3kl! Kljkoljkw rq rii3xo! Xqghuolqh rq rii3eol...
Page 42
3-16 7deoh6xppdu\ri6wdwxv4xhulhvdqg5hsruwv frqwlqxhg +267&200$1' 7&65(63216( 0($1,1* (6&!>! 3vfu!Q 5hdg6fuhhq([lvwhqfh&rppdqg (6&!>!Q 6fuhhq3vfu!Grhvqrwh[lvw (6&!>!Q 6fuhhq3vfu!Grhvh[lvw.
Page 43: 6800$5
3-17 6800$5 a tcs mode is a state that can be set or reset by the host or user to control tcs operation. The tcs supports several modes specified by the ansi standard. In addition, the tcs supports several dec-private and tcs-private modes. Table 3-4 provides a summary of these modes. Note all tcs m...
Page 44
3-18 7deoh6xppdu\ri6hohfwdeoh0rghv 02'( 01(021,& 6285&( 3v! $16,6shflilhg0rghv .H\erdug/rfnrxw 0rgh .$0 5hprwh 6hqg5hfhlyh0rgh 650 /rfdo5hprwh 1hz/lqh0rgh /10 /rfdo5hprwh '(&3ulydwh0rghv 6fuhhq%dfnjurxqg 0rgh '(&6&10 /rfdo5hprwh $xwr:uds$urxqg 0rgh '(&$:0 /rfdo5hprwh 2uljlq0rgh '(&20 5hprwh .H\sdg0r...
Page 45: 7&602'(&200$1'6
3-19 7&602'(&200$1'6 tcs mode commands set or reset one or more tcs modes. The tcs mode commands are: • reset mode (remote) • set mode (remote) these commands are described in detail in the following pages. For ease of reference, each command description begin on a new page. Note where applicable, c...
Page 46
3-20 5hvhw0rgh&rppdqg>50@5hprwh the reset mode command allows the host to reset one or more tcs modes of the same type (ansi-specified, dec-private or tcs-private). A detailed description of each tcs mode is provided with the description of the respective mode command in chapter 4. '()$8/7 each mode...
Page 47
3-21 (;$03/(6 [2;12l resets the ansi-specified modes, keyboard lockout mode [kam] and send-receive mode [srm]. [? 5 l resets the dec-private mode, screen background mode (decscnm). [> 3;1l resets the tcs-private modes, nochange attribute mode {fncam} and polled touch mode {fptm}..
Page 48
3-22 6hw0rgh&rppdqg>60@5hprwh the set mode command allows the host to set one or more tcs modes of the same type (ansi- specified, dec-private or tcs-private). A detailed description of each tcs mode is provided with the description of the respective mode in chapter 4. '()$8/7 each mode has its own ...
Page 49
3-23 (;$03/(6 [20h sets the ansi-specified mode, new line mode [lnm]. [?7h sets the dec-private mode, auto wrap-around mode (decawm). [>4;5h sets the tcs-private modes, power-up interrupt mode (fpuim) and setup lockout mode (fsulm)..
Page 50: &2/257&66800$5
3-24 &2/257&66800$5 the color tcs has eight basic colors programmed in read-only memory (rom): black, red, green, yellow, blue, magenta, cyan, and white. For each character on the display, the foreground color and background color can be programmed independently. The character colors are handled lik...
Page 51
3-25 &rqfhdolqj&roru&kdudfwhuv colors can be concealed using the set character attributes command to do two functions: • select a conceal color • select the concealed attribute for any characters you wish to temporarily conceal any of the eight basic colors can be selected as the conceal color. Norm...
Page 52: 6(5,$/,17(5)$&(
4-1 &+$37(5&21752//,1*7+(6(7836&5((1$1' 6(5,$/,17(5)$&( ,1752'8&7,21 this chapter describes the commands that control the setup screen and serial interface in the touch control screen (tcs). Topics include: • an overview of the volatility of tcs functions • setup screen programming considerations • ...
Page 53
4-2 7deoh2yhuylhzri)xqfwlrqdo9rodwlolw\ )81&7,21 ),56732:(583 25+$5'5(6(7 /$7(532:(583 2562)75(6(7 5(&$//6(783 &rppxqlfdwlrq $gguhvv6wdwh $gguhvvhg 8qdgguhvvhg &rqglwlrqdo $gguhvv 56 /dvwvdyhg /dvwvdyhg %dxg5dwh /dvwvdyhg /dvwvdyhg 'dwd%lwv /dvwvdyhg /dvwvdyhg 3dulw\(qdeoh 2ii /dvwvdyhg /dvwvdyhg 3d...
Page 54
4-3 7deoh2yhuylhzri)xqfwlrqdo9rodwlolw\ &rqwlqxhg )81&7,21 ),56732:(583 25+$5'5(6(7 /$7(532:(583 2562)75(6(7 5(&$//6(783 'lvsod\hg6fuhhq &roru&rqwudvw 'hidxow /dvwvdyhg /dvwvdyhg &xuvru3rvlwlrq +rph +rph 8qfkdqjhg &xuvru7\sh 6orzeolqnlqjeorfn /dvwvdyhg /dvwvdyhg 6fuhhq%dfnjurxqg 1rupdo /dvwvdyhg /dv...
Page 55
4-4 7deoh2yhuylhzri)xqfwlrqdo9rodwlolw\ &rqwlqxhg )81&7,21 ),56732:(583 25+$5'5(6(7 /$7(532:(583 2562)75(6(7 5(&$//6(783 .H\erdug 6hw8s/rfnrxw0rgh 8qorfnhg 8qorfnhg 8qfkdqjhg .H\erdug/rfnrxw0rgh 8qorfnhg 8qorfnhg 8qfkdqjhg &dsv/rfn 8qorfnhg 8qorfnhg 8qfkdqjhg 6furoo/rfn 8qorfnhg 8qorfnhg 8qfkdqjhg ....
Page 56
4-5 6(7836&5((1352*5$00,1*&216,'(5$7,216 the following paragraphs explain how the host can interact with the setup screen. For setup screen operating instructions, refer to the installation guide. For additional information about particular modes, refer to the table "summary of tcs commands" in chap...
Page 57
4-6 +rvw&rppxqlfdwlrqgxulqj6hwxs6hvvlrq while the setup screen is displayed, the tcs continues to receive codes from the host but does not display or otherwise act on them. The tcs stores the codes until its input buffer is 75% full, at which time the tcs stalls the host. When the setup screen is ex...
Page 58
4-7 the recall setup command replaces all the setup parameters with the values stored by the last save setup command. Recall setup is executed when the user presses recall on the setup screen (or types shift/r on the keyboard), or when the host sends the remote command recall setup. (see recall setu...
Page 59
4-8 &roruv8vhgwr'lvsod\wkh6hwxs6fuhhqdqg,wv6xevfuhhqv the setup screen and its subscreens are displayed using the white foreground and blue background whenever the setup screen is entered. The numeric values shown in the above table indicate the colors last set by the set character attributes comman...
Page 60
4-9 3hupdqhqfhri&kdqjhvwr6hwxs3dudphwhuv to ensure that the setup parameter values currently in use are saved while the tcs is turned off, a save setup command must be executed. The save setup command causes the tcs to store the setup parameters in nonvolatile setup memory for automatic recall at th...
Page 61: 6(7836&5((1&200$1'6
4-10 6(7836&5((1&200$1'6 the setup screen commands are used to control the user’s access to the setup screen, and to save, recall, or reset setup parameters remotely. The setup screen commands are: • setup lockout mode (remote) • save setup (local/remote) • recall setup (local/remote) • reset (local...
Page 62
4-11 6hwxs/rfnrxw0rgh&rppdqg^)68/0`5hprwh the setup lockout mode command allows the host to lock the user out of the setup screen. This command is useful when the other methods of preventing the user from changing setup screen parameters (locking the entire keyboard or making the set up switch inacc...
Page 63
4-12 6dyh6hwxs&rppdqg^)668`/rfdo5hprwh the save setup command saves the current values of the setup parameters in nonvolatile setup memory. The saved setup parameter values are automatically recalled when the tcs is turned on or when a recall setup command or soft reset command is issued by the user...
Page 64
4-13 5hfdoo6hwxs&rppdqg^)568`/rfdo5hprwh the recall setup command allows the user or host to recall the setup parameters that were in effect when the save setup command was last executed. When the recall setup command is issued, the setup parameters in effect at the time are overwritten by the most ...
Page 65
4-14 5hvhw&rppdqg>5,6@/rfdo5hprwh the reset command allows the user or host to reset the tcs. The host can perform a soft or hard reset. The user can perform the soft reset only. Table 4-1 summarizes the effects of the hard and soft resets. The soft reset is the type of reset most frequently used. I...
Page 66
4-15 3266,%/((55256 when performing a soft reset remotely, use caution to avoid accidentally disrupting the communication between the tcs and the host. A soft reset reinitializes the host interface communication parameters such as baud rate, data bits, or parity sense, using the values saved by the ...
Page 67: &20081,&$7,21&200$1'6
4-16 &20081,&$7,21&200$1'6 the communication commands have three functions: • configuring the serial interface to meet the communication requirements of the host • selecting whether the tcs accepts remote commands from the host computer or from the keyboard • clearing user inputs for a description o...
Page 68
4-17 $gguhvv&rppdqg/rfdo the address command is used to specify the interface or when connected to the host in a multidrop configuration to set the address to which the tcs responds. In rs-485, the address determines when and if the tcs is allowed to transmit over the communication link. It also det...
Page 69
4-18 7deoh0xowlgurs$gguhvvhvdqg&rghv frqwlqxhg ,iwkh$gguhvvlv 7&65hvsrqgvwr$gguhvv&rgh +(;$6&,,9doxh * + , - $ . % / & 0 ' 1 ( 2 ) 3 if the address is set to “rs232” or “rs-422” the tcs and host communicate as if they were the only devices on the communication link. The tcs leaves its transmitter co...
Page 70
4-19 refer to chapter 2, multidrop communication protocol for a complete description of the purpose, implementation, and implications of multidrop protocol. '()$8/7 “rs232” 23(5$72586$*( the user sets the address by entering the setup screen and setting the address parameter to the desired value usi...
Page 71
4-20 %dxg5dwh&rppdqg/rfdo the baud rate command sets the transmission and reception speed to one of eight baud rates. The baud rate is selected by setting the baud rate parameter on the setup screen to one of the following values: 110, 300, 600, 1200, 2400, 4800, 9600, and 19200. The baud rate setti...
Page 72
4-21 'dwd%lwv&rppdqg/rfdo the data bits command selects either seven or eight data bits per ascii code. The number of data bits is selected by the user, who sets the data bits parameter on the setup screen to either 7 or 8. If the data bits parameter is set to 7, the next seven bits (following the s...
Page 73
4-22 3dulw\(qdeoh&rppdqg/rfdo the parity enable command enables or disables parity checking and generation. (for an explanation of parity checking, see parity bit, in chapter 2.) parity checking and generation are enabled or disabled by setting the parity enable parameter on the setup screen to one ...
Page 74
4-23 3dulw\6hqvh&rppdqg/rfdo the parity sense command determines whether the tcs uses odd or even parity checking and generation for communication with the host. (for an explanation of parity checking, see parity bit, in chapter 2.) parity checking is only active when parity enable is set to "on." p...
Page 75
4-24 6wrs%lwv&rppdqg/rfdo the stop bits command sets the tcs to send and receive codes with either one or two stop bits. The number of stop bits is selected by setting the stop bits parameter on the setup screen to either 1 or 2. If the stop bits parameter is set to l, then only one stop bit per cod...
Page 76
4-25 ;21;2))0rgh&rppdqg/rfdo the xon/xoff mode command sets or resets the tcs xon/xoff mode. On the setup screen, the user can select one of the following parameters: • on • off the xon/xoff mode determines whether the tcs uses xon and xoff codes for communication flow control. Regardless of the xon...
Page 77
4-26 '()$8/7 on. (xon/xoff mode is enabled.) 23(5$72586$*( the user selects the xon/xoff mode by entering the setup screen and setting the xon/xoff mode parameter to the desired value using touchkeys or the optional keyboard. +26786$*( none. (this is a local command only.).
Page 78
4-27 /rfdo5hprwh0rgh&rppdqg/rfdo the local/remote mode command controls whether the tcs accepts remote commands from the host computer or from the optional keyboard. The local/remote command sets the tcs either to the remote mode (in which the tcs accepts remote commands from the host) or to the loc...
Page 79
4-28 +dugzduh+dqgvkdnh/rfdo the hardware handshake command determines which rs-232 handshake signals must be asserted before the tcs will transmit. In rs-232 systems, both cts and dsr must be asserted before the terminal can transmit. This causes problems in three-wire systems (rx, tx, and gnd) wher...
Page 80
4-29 7udqvplw0rgh&rppdqg/rfdo the transmit mode command set the transmit buffer mode of the tcs. The uart in the tcs has a two character transmit buffer. When the host stalls the tcs, the terminal will terminate transmission after the transmit buffer is emptied. In some systems, the host is not capa...
Page 81
4-30 5hsruwlqj)rupdw&rppdqg^)5)`5hprwh the reporting format command allows the host to specify non-standard introducing codes and a terminating code for all report sequences generated by the tcs. This command allows the programmer to tailor tcs reports to match the format required by a particular ho...
Page 82
4-31 note if or are omitted, their places must be held with semicolons. For example, to select the default value for , use the command [;;w. And substitute for previous introducer codes; does not. Is appended after the existing final code. 3266,%/((55256 when the data bits parameter is set to 7, par...
Page 83
4-32 &ohdu8vhu,qsxwv&rppdqg^)&8,`5hprwh the clear user inputs command allows the host to clear the output buffer of the tcs. The tcs output buffer contains user input not yet transmitted to the host, and any untransmitted responses to the host’s queries for status information. This command is useful...
Page 84: &20081,&$7,21021,725
4-33 &20081,&$7,21021,725 the communication monitor provides easy troubleshooting of communications between the host and tcs. Once the communication monitor is entered, the tcs translates all codes that cross the communications link directly into their equivalent characters for display. While the co...
Page 85
4-34 if the default mapping is not in effect for the displayed screen, the tcs displays whatever character corresponds to the code crossing the communication link, according to the character font mapping in effect. See chapter 5 for details about character font mapping. )ljxuh6dpsoh&rppxqlfdwlrq0rql...
Page 86
4-35 for example, if a code (ascii 07 hex) is received from the host, and default character font mapping is in effect, the communication monitor displays l, but the beeper is not sounded. Two types of control codes are both displayed and acted on: • stall and unstall codes continue to control the da...
Page 87
4-36 if the keyboard or touch panel were locked out before entering the setup screen, they will remain locked while in the communication monitor. Exiting the communication monitor to the setup screen will cause the keyboard or touch panel to be temporarily unlocked if either one was locked. 8vlqjwkh...
Page 88: &+$37(5',63/$
5-1 &+$37(5',63/$ ,1752'8&7,21 this chapter explains how to display characters on the touch control screen (tcs) and alter the appearance of the screen. Topics include a description of the available character sets and related commands. For clarity of organization and ease of reference, the command d...
Page 89
5-2 because each character set contains 128 characters, graphic codes with values less than 128 decimal (80 hexadecimal) display characters from within the standard character set. Graphic codes with values greater than or equal to 128 decimal (80 hexadecimal) display characters from within the exten...
Page 90
5-3 67$1'$5' &+$5$&7(5 6(7 (;7(1'(' &+$5$&7(5 6(7 $&&(66(' % ) kh[ ghflpdo $&&(66(' % ) kh[ ghflpdo )ljxuh&rghv$ffhvvwkh&kdudfwhu6hwv an area within each screen is defined to be a scrolling region. This is so characters can continue to be displayed without running off the bottom of the screen. When ...
Page 91
5-4 7deoh)rupdw(iihfwruv 01(021o& +(;9$/8( 1$0( 029(0(172)&85625 )227127( %6! %dfnvsdfh %dfnzdugrqhfroxpq +7! +rul]rqwdo7de )ruzdugwrqh[wwde /)! $ /lqh)hhg 'rzqrqholqh 97! % 9huwlfdo7de 'rzqrqholqh ))! & )rup)hhg 'rzqrqholqh &5! ' &duuldjh5hwxuq %dfnwriluvwfroxpq ,1'! ,qgh[ 'rzqrqholqhvdphfroxpq 1(/...
Page 92: 29(59,(:2)6&5((10(025
5-5 29(59,(:2)6&5((10(025 ,qwurgxfwlrq the tcs can locally store multiple screens of information for later display upon host command. Each screen contains a complete set of display data and touch-panel programming representing a stand-alone user interface. This advanced capability allows the host to...
Page 93
5-6 selected screen screen 0 screen 0 screen 0 screen 0 crt host stored screens (invisible) displayed screen )ljxuh6hohfwlqjd6fuhhqiru(glwlqj figure 5-2 shows how the multiple screens within the tcs are arranged. Notice that the host is always editing the selected screen, which can be the displayed ...
Page 94
5-7 7huplqrorj\6fuhhqyv'lvsod\ commands that modify the display data or touch-programming within a screen often use the terms "screen" and "display" interchangeably. In both cases, the command affects only the screen that is currently selected for editing by the host. Since in the majority of instan...
Page 95: 6&5((10(025
5-8 6&5((10(025 seven commands create, modify, delete, and indicate the status of screens stored in memory. All screen commands are remote; the host can issue them but the user normally cannot. Remote commands can be issued by the user at the tcs only by first setting local mode. The screen memory c...
Page 96
5-9 ,qlwldol]h6fuhhq&rppdqg^),6`5hprwh the initialize screen command returns a screen to the default state. When changes have been made to a screen, the initialize screen command prevents the host from having to send all the individual commands needed to return the screen to its default state. The i...
Page 97
5-10 23(5$72586$*( none. (this is a remote command only.) +26786$*( [3s 3266,%/((55256 none. (;$03/( [2;20s [3s these commands first select, then initialize stored screen 20 with the default values. If screen 20 existed before being selected, the initialization command reinitializes it with the defa...
Page 98
5-11 6hohfw6fuhhq&rppdqg^)66`5hprwh the select screen command provides a way for the host to edit a screen without necessarily changing the displayed screen. After this command is issued, all screen-dependent commands have an effect only on the selected screen; other screens are not affected. The sc...
Page 99
5-12 touchkey visual extent {ftkve} touchkey audible attribute {ftkaa} character displaying commands display double-width line {decdwl} display double-size line {decdhl} display normal line {decswl} place double-size line {fdsl} erase character [ech] erase in line [el] erase in display [ed] draw bar...
Page 100
5-13 when the host selects a stored screen, the displayed screen is still available for user input: • touch reports sent to the host as a result of touchkey activity or in response to the read touchkey status command reflect the touchkeys that are part of the displayed screen. • all automatic visual...
Page 101
5-14 3266,%/((55256 use care when editing a stored screen if the screen memory is almost full (see the read screen memory remaining command). Changing text, attributes, or touch programming may increase the complexity of the screen and require more memory space. This situation can cause an memory fu...
Page 102
5-15 &rs\6fuhhq&rppdqg^)&6`5hprwh the copy screen command copies the contents of one screen to one or more other screens. The command copies all values, modes, display data, and touch programming. The copy screen command is used as follows: • to display a stored screen, copy it into the displayed sc...
Page 103
5-16 23(5$72586$*( none. (this is a remote command only.) +26786$*( [1;;;... ; s is a numeric parameter from 0 through 256 that specifies the number of the source screen. The displayed screen is 0 and stored screens are non-zero. If is omitted, 0 is used, and the displayed screen is the source. Is a...
Page 104
5-17 'hohwh6fuhhq&rppdqg^)'6`5hprwh the delete screen command deletes one or more stored screens. When a screen is deleted, the memory used to store it becomes available for storing other screens. It is not possible to delete the displayed screen because it always exists. 23(5$72586$*( none. (this i...
Page 105
5-18 'hohwh$oo6fuhhqv&rppdqg^)'$6`5hprwh the delete all screens command deletes all the stored screens. 23(5$72586$*( none. (this is a remote command only.) +26786$*( [5s (;$03/( [5s delete all existing stored screens. Caution use the delete all screens command with care because all stored screens w...
Page 106
5-19 5hdg6fuhhq0hpru\5hpdlqlqj&rppdqg^)5605`5hprwh the read screen memory remaining command provides a way for the host to determine how much space is available for creating new screens. Since memory can become too full for any more screens to be created, it is sometimes helpful to know how close th...
Page 107
5-20 (;$03/(6 [> 10n host requests a report of screen memory remaining. If no screens have been stored yet, the tcs responds: [> 10;0;0;94464n [>10n host requests a screen memory remaining report. If almost all of screen memory has been used up, the tcs responds: [>10;56;93758;0;606n even though the...
Page 108
5-21 5hdg6fuhhq([lvwhqfh&rppdqg^)56(`5hprwh the read screen existence command provides a way for the host to determine if a particular screen exists. The command inquires about the existence of one screen at a time. The displayed screen always exists; any other screen exists only if it was stored in...
Page 109
5-22 (;$03/(6 [> 12;87n host asks if screen 87 exists. If this screen does not currently exist the tcs responds: [>12;0n [>12;1n host requests whether screen number 1 exists. If this screen exists, the tcs responds: [>12;1n [>12n host is requesting if the displayed screen exists. The displayed scree...
Page 110: )2176
5-23 29(59,(:2)&+$5$&7(56(76$1'&+$5$&7(5 )2176 because the contents of the standard and extended character sets determine how characters appear when graphic codes are sent by the host, the tcs allows the contents of these two character sets to be altered by the host program at will. To facilitate ch...
Page 111
5-24 unless the host specifies otherwise, dynamic character font 1 contains a copy of the static ascii character font and dynamic character font 2 contains a copy of the static special character font. The default contents of these two fonts are shown in appendix c. 0dqlsxodwlqj&kdudfwhu6hwvdqg)rqwv ...
Page 112
5-25 the designated character set so the contents of the character set match that of the character font. 4. If the host subsequently changes the contents of a dynamic character font that is mapped into one of the character sets, the change is reflected immediately in the appropriate character set an...
Page 113
5-26 9rodwlolw\riwkh'\qdplf&kdudfwhu)rqwv the dynamic character fonts are automatically stored in non-volatile memory. This ensures that the dynamic character fonts have the same volatility characteristics as the stored screens that use them. &kdudfwhu6hw$qg&kdudfwhu)rqw&rppdqgv the following pages ...
Page 114
5-27 6hohfw&kdudfwhu6hw&rppdqg>6&6@5hprwh the select character set command provides the mechanism for addressing the extended character set when the serial interface is set to operate with seven data bits. When seven data bits are used, the standard character set and the extended character set are b...
Page 115
5-28 +26786$*( ( shift out , 14 decimal, e hex) selects the extended character set. ( shift in, 15 decimal, f hex ) selects the standard character set. 3266,%/((55256 when the extended character set is selected, this command has priority over any national replacement code (nrc) that may be in effect...
Page 116
5-29 0ds&kdudfwhu)rqw&rppdqg^)0&)`5hprwh static ascii character font dynamic character font 1 standard character set extended character set dynamic character font 2 static special character font default default )ljxuh&kdudfwhu)rqw0ds2shudwlrqv the map character font command allows the host to map an...
Page 117
5-30 when a character font is mapped into a character set, it is as if the contents of the character set have been temporarily replaced with those of the character font. However, it is more than just a copy operation because subsequent changes to the character font are immediately reflected in the c...
Page 118
5-31 7deoh6wdqgdug&kdudfwhuv8vhg)ru6shfldo3xusrvhv '(6&5,37,21 &255(6321',1*' &+$5$&7(5)217 326,7,216'(&,0$/ &216(48(1&(,)&+$1*('% /,1(/2$'$1'0$3&+$5$&7(5)217&200$1'6 &rqwurofrgh pqhprqlfv wkurxjk 6hyhqelwfrqwurofrghvzlooehglvsod\hgxvlqjfxvwrp fkdudfwhuvzlwklqwkh&rppxqlfdwlrq0rqlwru 6sdfhfkdudfwhu 6...
Page 119
5-32 7deoh([whqghg&kdudfwhuv8vhgiru6shfldo3xusrvhv frqwlqxhg '(6&5,37,21 &255(6321',1*' &+$5$&7(5)217 326,7,216'(&,0$/ &216(48(1&(,)&+$1*('% /,1(/2$'$1'0$3&+$5$&7(5)217&200$1'6 )udplqjhuuru fkdudfwhu &rppxqlfdwlrqviudplqjhuuruvglvsod\wkhfxvwrpfkdudfwhu 3dulw\huurufkdudfwhu &rppxqlfdwlrqvsdulw\huuruv...
Page 120
5-33 indicating communication errors. Because of the possible confusion this could cause, this command is not recommended.. )3 map the static special character font into the extended character set. This is the default condition. )2 map dynamic character font 2 into the extended character set. Mappin...
Page 121
5-34 &rs\&kdudfwhu)rqw&rppdqg^)&&)`5hprwh the copy character font command allows the host to initialize the contents of the dynamic character fonts. This command might be issued as the first step in creating a new dynamic character font. The copy character font command allows the contents of any of ...
Page 122
5-35 = omitted or 0: not a valid destination font 1: dynamic character font 1 2: dynamic character font 2 3: not a valid destination font 3266,%/((55256 the copy character font command is ignored if an attempt is made to copy into one of the static character fonts, which cannot be changed. The copy ...
Page 123
5-36 'rzq/lqh/rdg&kdudfwhu)rqw&rppdqg^)'/&)`5hprwh the down-line load character font command allows the host to place custom characters into dynamic character fonts 1 and 2. Then, when the dynamic character font is mapped into the standard or extended character set, the custom characters can be disp...
Page 124
5-37 )ljxuh([dpsoh&xvwrp&kdudfwhu'hvljq it might seem that the simplest way to encode this character for transmission is to send 10 bytes with each of the 8 bits in the byte representing a dot. There are two reasons why this method is not acceptable: 1. The host and tcs may be communicating using on...
Page 125
5-38 )ljxuh'lylglqjwkh&kdudfwhulqwr6l[hov convert the binary values of each column to ascii characters. Column codes are restricted to the range of 63 through 126 decimal (? To ~), so add an offset of decimal 63 (binary 111111) to each column value. Thus, the lowest binary value (000000) becomes dec...
Page 126
5-39 6800$5 to down-line load a custom character font, do the following: 1. Design the characters in a matrix 8 dots wide by 10 dots high. 2. Divide the characters into 2 sets of 8 sixels each sixes having 6-bit positions. The upper set is complete (6-bit sixels) and the lower one is made up of 4-bi...
Page 127
5-40 )ljxuh(qfrglqjwkh6l[hov.
Page 128
5-41 6$03/(352*5$0)256,;(/&219(56,21 a second shortcut might be to use a program to convert the bit patterns into the sixel codes. The following example program asks for 8 upper sixels, then for 8 lower sixels. The resulting codes are stored as characters in a string, and then displayed. The program...
Page 129
5-42 460 ‘ 470 if mid$(pixrow$(row%),column%,1)= “*” then pixelon%= 1 480 ‘ 490 ‘ adjust value if pixel is on. 500 ‘ 510 if pixelon% = 1 then sixel% = sixel% + binval%(row%) 520 ‘ 530 ‘ add correct binary value if 540 ‘ the pixel is on (if the pixel 550 ‘ is off nothing is added). 560 next row% ‘ en...
Page 130
5-43 23(5$72586$*( none. (this is a remote command only.) +26786$*( p ;;{;;... ; \ can be used in place of p and can be used in place of \ when the tcs is communicating using 8 data bits. Is a numeric parameter that specifies which dynamic character font is to be loaded. When is: 0 or omitted: load ...
Page 131
5-44 3266,%/((55256 if no sixel bit patterns are specified and is 1, none of the characters in the dynamic font buffer are changed. If incomplete sixel patterns are given for a character, the incomplete portions of the character cell will be blank (matching the screen background). If extra sixel pat...
Page 132: &+$5$&7(5',63/$
5-45 &+$5$&7(5',63/$ the character displaying commands display and erase characters on the screen and modify their appearance. These commands affect the characters already on the screen when the command is executed. The character displaying commands are: • display double-width line command (remote) ...
Page 133
5-46 'lvsod\'rxeoh:lgwk/lqh&rppdqg^'(&':/`5hprwh the display double-width line command displays the line occupied by the cursor (and only that line) using double-width characters. Since each double-width character occupies twice the normal character width, all characters occupying the right half of ...
Page 134
5-47 'lvsod\'rxeoh6l]h/lqh&rppdqg^'(&'+/`5hprwh the display double-size line command changes the line occupied by the cursor to appear as a double-size line. Double-size lines are both double-height and double-width. Each of the two lines that make up the double-size line is also double-width, so th...
Page 135
5-48 3odfh'rxeoh6l]h/lqh&rppdqg^)'6/`5hprwh the place double-size line command creates a double-size line with a single command, providing a simpler alternative to the display double-size line command for making a double- size line. When this command is processed, the text and attributes on the line...
Page 136
5-49 (;$03/(6 #2 change the line that the cursor is on to display the top half of double-size characters currently in the line. Change the line below the cursor to display the bottom half of double-size characters currently in the line the cursor is on..
Page 137
5-50 'lvsod\1rupdo/lqh&rppdqg'(&6:/5hprwh the display normal line command displays the line occupied by the cursor (and only that line) using normal characters. To normalize a double-size line, the host must send the display normal line command for both of the lines that make up the double-size line...
Page 138
5-51 'udz%duiru%du&kduw&rppdqg^)'%%`5hprwh the draw bar for bar chart command provides a convenient way to display and update a bar chart. The command supports both horizontal or vertical bar charts. To use the command, the host specifies: • the maximum length or height of the bar • the amount of th...
Page 139
5-52 the area of the display this command affects is restricted to the scrolling region when origin mode is set. 23(5$72586$*( none. (this is a remote command only.) +26786$*( [1;;; ;x is a numeric parameter specifying the maximum size in lines (vertical bar) or characters (horizontal bar) of the ba...
Page 140
5-53 the bar may appear jagged if it crosses a mixture of line types. If the extended character set does not have the appropriate characters (for example, default dynamic font 1 copied to extended set) the bar will not appear correctly. (;$03/(6 [1;20;665x draws a vertical bar 66.5% of 20 lines high...
Page 141
5-54 (udvh&kdudfwhu&rppdqg>(&+@5hprwh the erase character command erases the character under the cursor and as many characters as desired following it up to the end of the line. Each character erased is replaced by a blank (the ascii space character) with character attributes "off." the cursor does ...
Page 142
5-55 (udvhlq/lqh&rppdqg>(/@5hprwh the erase in line command erases a specified chapter of the line occupied by the cursor. Each character erased is replaced by a blank (the ascii space character) with character attributes "off." the cursor does not move when the tcs executes this command. Note if th...
Page 143
5-56 if is 1, characters from the start of the line through the cursor are erased. If is 2, the entire line is erased. (;$03/(6 [k erases from the cursor through the end of the line. The cursor is not moved. [2k erases the entire line. The cursor is not moved..
Page 144
5-57 (udvhlq'lvsod\&rppdqg>('@5hprwh the erase in display command erases all or part of the display. This command can be used to erase the area preceding the cursor, the area following the cursor, or the entire screen. Each erased character is replaced by a blank (the ascii space character, 20 hex) ...
Page 145
5-58 if is 1, characters from the beginning of the screen through the cursor position (inclusive) are erased. If is 2, the entire screen is erased. (;$03/(6 [j erases from the cursor through the end of the screen. The cursor does not move. The line containing the cursor retains its line type; all ot...
Page 146
5-59 &+$5$&7(5,17(535(7$7,21&200$1'6 character interpretation commands determine the appearance and placement of characters that arrive after the command is received. The character interpretation commands are: • auto wrap-around mode command (local/remote) • send-receive mode command (local/remote) ...
Page 147
5-60 $xwr:uds$urxqg0rgh&rppdqg'(&$:0/rfdo5hprwh the auto wrap-around mode command sets and resets the auto wrap-around mode. The auto wrap-around mode determines how the cursor responds when the tcs receives characters that run off the right margin of the display. • when the auto wrap-around mode is...
Page 148
5-61 6hqg5hfhlyh0rgh&rppdqg>650@/rfdo5hprwh the send-receive mode command sets and resets the send-receive mode, which controls the local echo feature of the tcs. The local echo feature echoes user input from the optional keyboard to the tcs. Touch cell reports and other tcs-to-host strings are not ...
Page 149
5-62 1hz/lqh0rgh&rppdqg>/10@/rfdo5hprwh the new line mode command determines which control characters are transmitted by the tcs when the return key or enter key is pressed on an optional keyboard. The new line mode command also determines the action taken by the tcs when it receives line feed , for...
Page 150
5-63 12&+$1*($wwulexwh0rgh&rppdqg^)1&$0`5hprwh the nochange attribute mode command sets and resets the nochange attribute mode. The nochange attribute mode allows the host to freeze the visual attributes (character attributes and line type) of the display. When the nochange attribute mode is set, th...
Page 151
5-64 7deoh&rppdqgv$iihfwhge\ 12&+$1*( $wwulexwh0rgh &200$1' 23(5$7,212)&200$1':+(1 12&+$1*($775,%87(02'(,65(6(7 2)) 23(5$7,212)&200$1':+(1 12&+$1*($775,%87(02'(,66(7 21 &kdudfwhuvvhqwiru glvsod\ &kdudfwhuvduhglvsod\hg &kdudfwhudwwulexwhvduhghwhuplqhge\wkh 6hw&kdudfwhu$wwulexwhvfrppdqg &kdudfwhuvduhg...
Page 152
5-65 7deoh&rppdqgv$iihfwhge\ 12&+$1*( $wwulexwh0rgh frqwlqxhg &200$1' 23(5$7,212)&200$1':+(1 12&+$1*($775,%87(02'(,65(6(7 2)) 23(5$7,212)&200$1':+(1 12&+$1*($775,%87(02'(,66(7 21 )loo5hjlrqzlwk &kdudfwhu &kdudfwhuvduhuhsodfhg &kdudfwhudwwulexwhvduhghwhuplqhge\wkh 6hw&kdudfwhu$wwulexwhvfrppdqg &kdudf...
Page 153
5-66 d) the host replaces the earlier warning message with the new message, "danger... Over limit." the new message is displayed with the same attributes as the previous warning message (highlighted). The host can continue to update the various messages on the screen using their previous character a...
Page 154
5-67 1dwlrqdo5hsodfhphqw&rgh&rppdqg^)15&`/rfdo5hprwh the national replacement code (nrc) command lets the user or host substitute a designated set of international characters in place of some standard ascii characters on the display. This command allows text containing characters unique to one of 11...
Page 155
5-68 • finnish • german • italian • spanish • swedish • swiss • uk +26786$*( [4 ; z is the nrc selective parameter. If nrc is 0 off 1 danish 2 dutch 3 french 4 canadian 5 finnish 6 german 7 italian 8 spanish 9 swedish 10 swiss 11 uk 3266,%/((55256 if the extended character set is selected by the sel...
Page 156
5-69 (;$03/(6 [4;7z sets the nrc to italian. [4z sets the nrc to "off". (no replacements are made.) [4;11z sets the nrc to uk ..
Page 157
5-70 7deoh1dwlrqdo5hsodfhphqw&rgh&kdudfwhuv 1$7,21$/,7 &+$5$&7(5 5(&(,9(' &+$5$&7(5 ',63/$ '(6&5,37,212) ',63/$ &+$5$&7(5 'dqlvk # @ @ ? Ö c ` ^ _ a b c h l n ¡ $xpodxw $ulqj $(oljdwxuh 26odvk 8xpodxw dxpodxw dulqj dholjdwxuh rvodvk xxpodxw 'xwfk # > ? @ ^ _ ` a ô lm ò _ ¦ ó ¶ srxqgv\pero iudfwlrq l...
Page 160
5-73 6hw&kdudfwhu$wwulexwhv&rppdqg>6*5@0rqrfkurph5hprwh &roru/rfdo5hprwh the set character attributes command selects the visual attributes for displayed characters. Separate parallel areas within memory store characters and their attributes. A convenient visual model is to think of the display as b...
Page 161
5-74 • underline the character is underlined. • blink the character blinks on or off every second with a 50% duty cycle. Note a 50% duty cycle means the character is "on" half of the time. • reverse-video the character cell foreground matches the screen background, and the character cell background ...
Page 162
5-75 '()$8/76 the highlight, underline, blink, reverse-video, and concealed attributes are turned off. Color tcs: the foreground color is white (37) and the background is black (40). The conceal color is black (70). 23(5$72586$*( for the monochrome tcs, this is a remote command only. Color tcs: fore...
Page 163
5-76 7deoh&roru3dudphwhuvriwkh6hw&kdudfwhu$wwulexwhv&rppdqg frqwlqxhg &2/25 )25(*5281' %$&.*5281' &21&($/ %oxh 0djhqwd &\dq :klwh 3266,%/((55256 if the host specifies two or more incompatible character attributes in the same control (such as concealed followed by not concealed), the last character a...
Page 164
5-77 6furoolqj5hjlrq&rppdqg'(&67%05hprwh the scrolling region command limits scrolling to a portion of the screen. This feature is useful when one area of the screen must display immobile objects (such as touch targets) while another area of the screen displays scrolling information. A scrolling reg...
Page 165
5-78 +26786$*( [;r is a numeric parameter, designating the top line of the scrolling region. If is omitted or 0, the top line of the scrolling region is set to line 1. Is a numeric parameter, designating the bottom line of the scrolling region. If is omitted or 0, the bottom line of the scrolling re...
Page 166
5-79 2uljlq0rgh&rppdqg'(&205hprwh the origin mode command sets or resets the origin mode. The origin mode performs three functions: it determines whether the lines of the screen are numbered relative to the screen as a whole or relative only to the scrolling region; whether the cursor can be moved o...
Page 167
5-80 when the origin mode is set (on): • line numbering begins with line 1 at the top of the scrolling region and continues through the bottom of the scrolling region. • the cursor cannot be moved out of the scrolling region. • the erase in display and region commands affects the scrolling region. •...
Page 168
5-81 23(5$72586$*( none. (this is a remote command only.) +26786$*( [?6l resets the origin mode. (the terminator for the reset command is the letter "l", ascii 6c hex.) [?6h sets the origin mode..
Page 169: &85625&200$1'6
5-82 &85625&200$1'6 the cursor commands determine the appearance and/or location of the cursor. The cursor commands are: • move cursor to absolute position command (remote) • move cursor to touchkey command (remote) • move cursor forward command (remote) • move cursor backward command (remote) • mov...
Page 170
5-83 0ryh&xuvruwr$evroxwh3rvlwlrq&rppdqg>&83@>+93@5hprwh the move cursor to absolute position command moves the cursor to an absolute character position on the screen, specified in lines and columns. The maximum number of lines is 24. On a normal line, the maximum number of columns is 80; on a doubl...
Page 171
5-84 (;$03/(6 [h moves the cursor home (line 1, column 1). [5;062h moves the cursor to line 5, column 62. [24h moves the cursor to line 24, column 1. [;30h moves the cursor to line 1, column 30. [30h moves the cursor to line 24, column 1. ( is greater than 24; therefore, the cursor moves to the last...
Page 172
5-85 0ryh&xuvruwr7rxfknh\&rppdqg^)0&7.`5hprwh the move cursor to touchkey command provides a way to easily position the cursor at a particular touchkey without specifying character coordinates. Then, using relative cursor movement commands and text display commands, the host can change the visual da...
Page 173
5-86 0ryh&xuvru)ruzdug&rppdqg>&8)@5hprwh the move cursor forward command is a relative cursor movement command. It moves the cursor forward (towards the right) without affecting its vertical position. The cursor cannot be moved beyond the right margin of the screen by this command. The cursor remain...
Page 174
5-87 0ryh&xuvru%dfnzdug&rppdqg>&8%@5hprwh the move cursor backward command is a relative cursor movement command. It moves the cursor backward (left) on the screen without affecting its vertical position. The cursor cannot be moved beyond the left margin of the current line with this command. The cu...
Page 175
5-88 0ryh&xuvru8s&rppdqg>&88@5hprwh the move cursor up command is a relative cursor movement command. It moves the cursor up the screen without affecting its column position. Once the cursor enters a scrolling region, the cursor cannot be moved outside the scrolling region with a relative cursor mov...
Page 176
5-89 0ryh&xuvru'rzq&rppdqg>&8'@5hprwh the move cursor down command is a relative cursor movement command. It moves the cursor down the screen without affecting its column position. Once the cursor enters a scrolling region the cursor cannot be moved outside the scrolling region with a relative curso...
Page 177
5-90 1h[w/lqh&rppdqg>1(/@5hprwh the next line command is a relative cursor movement command. It moves the cursor to column 1 (the first position) on the next line. The next line command has the following effects: • if the cursor is on the bottom line of the scrolling region when the command is recei...
Page 178
5-91 ,qgh[&rppdqg>,1'@5hprwh the index command is a relative cursor movement command. It moves the cursor down one line without affecting its column position. The index command differs from the move cursor down command in that if the cursor is on the bottom line of the scrolling region when the inde...
Page 179
5-92 5hyhuvh,qgh[&rppdqg>5,@5hprwh the reverse index command is a relative cursor movement command. It moves the cursor up one line without affecting the cursor’s column position. The reverse index command differs from the move cursor up command in that if the cursor is on the top line of the scroll...
Page 180
5-93 5hdg&xuvru3rvlwlrq&rppdqg>&35@5hprwh the read cursor position command allows the host to determine the cursor’s position on the screen. After receiving the read cursor position command from the host, the tcs reports the vertical and horizontal position of the cursor by responding with a string ...
Page 181
5-94 5hdg&kdudfwhu8qghu&xuvru&rppdqg^)5&8&`5hprwh the read character under cursor command causes the tcs to identify (for the host) the character under the cursor, in effect, allowing the host to read any character displayed on the screen. The uses of this command include: • reading the entire scree...
Page 182
5-95 +26786$*( [>3n 3266,%/((55256 the tcs assumes that the nrc in effect when the read character under cursor command is sent is the same as when the character was originally displayed by the tcs. If this is not the case, when the read character under cursor command is received by the tcs, the tcs ...
Page 183
5-96 5hdg$wwulexwhv8qghu&xuvru&rppdqg^)5$8&`5hprwh the read attributes under cursor command allows the host to read the character attributes shown on the screen. The read attributes under cursor command is used to: • read the entire screen and send it to a printer. • save a message displayed on the ...
Page 184
5-97 the following parameters are valid for the color tcs only. Table 5-13 shows the definitions for the color attributes. Is the foreground color attribute is the background color attribute is the conceal color attribute that shows conceal color activity for the entire screen, regardless of cursor ...
Page 185
5-98 &xuvru7\sh&rppdqg>)&7@/rfdo5hprwh the cursor type command selects one of the following types of cursors: • non-blinking, reverse-video block the cursor appears as a reverse-video, full character cell block and does not blink. • slow-blinking, reverse-video block the cursor appears as a full cha...
Page 186
5-99 +26786$*( [;...;v is a selective parameter, designating a cursor type. If is 0 or omitted, the previous cursor type is made visible. If is 1, the current cursor type is made invisible. If is 2, the cursor is an underline. If is 3, the cursor is a reverse-video block. If is 4, the cursor is non-...
Page 187: 6&5((1$33($5$1&(&200$1'6
5-100 6&5((1$33($5$1&(&200$1'6 the screen appearance commands affect the appearance of the entire screen. The screen appearance commands are: • screen background mode command (local/remote) • display activity command (local/remote) these commands are described in detail in the following pages. For e...
Page 188
5-101 6fuhhq%dfnjurxqg0rgh&rppdqg'(&6&10/rfdo5hprwh monochrome tcs: the screen background mode command sets or resets the screen background mode, which determines whether the background of the screen is dark or light. • when the screen background mode is set ("reverse"), the background of each chara...
Page 189
5-102 'lvsod\$fwlylw\&rppdqg^)'$`/rfdo5hprwh the display activity command turns the display on or off, or programs an automatic timeout (the screen is automatically turned off) following periods of inactivity. Caution setting display activity off then saving the setup screen is a relatively common s...
Page 190
5-103 23(5$72586$*( the user sets the display activity by entering the setup screen and, using touchkeys or the optional keyboard, setting the display activity parameter to one of the following values: • on • off • timeout the display activity setting does not take effect until the setup screen is e...
Page 191: ,1752'8&7,21
6-1 &+$37(5352*5$00,1*7+(728&+3$1(/ ,1752'8&7,21 this chapter describes how to create touchkeys on the touch control screen (tcs). Topics include: • the touch panel • touch reporting • the commands used to create touchkeys and touch targets for ease of reference, the commands are divided into two gr...
Page 192
6-2 )ljxuh7rxfk&hoo1xpehu$vvljqphqwv 7rxfknh\vdqg7rxfk7dujhwv the host application program can incorporate touch cells into units called touchkeys. A touchkey can consist of a single touch cell or a group of cells that function as if they were a single touch cell. To show the tcs operator exactly wh...
Page 193
6-3 )ljxuh([dpsoh7rxfknh\ depending on the number of touch cells that have been grouped together, the term touchkey can refer to a single touch-sensitive area as large as the entire display or as small as a single touch cell. 7rxfknh\9lvxdo([whqw many applications need to be able to easily change th...
Page 194
6-4 )ljxuh7rxfknh\9lvxdo([whqw.
Page 195: 728&+5(3257,1*
6-5 728&+5(3257,1* the touch panel is divided into 12 rows and 10 columns of individual touch cells, one or more of which can form a single touchkey. (see figure 6-1.) each touchkey has a unique numeric value determined by the master cell in its upper left corner, which the tcs reports to the host. ...
Page 196: 728&+3$1(/&200$1'6
6-6 728&+3$1(/&200$1'6 the touch panel commands control the operation of the touch panel. The touch panel commands are: • build touchkey command (remote) • clear touchkey command (remote) • touchkey type command (remote) • touchkey visual extent command (remote) • touchkey audible attribute command ...
Page 197
6-7 %xlog7rxfknh\&rppdqg^)%7.`5hprwh the build touchkey command groups touch cells together into a single rectangular touchkey. Building touchkeys provides an easy way to handle larger portions of the touch panel as single touch-sensitive areas, and eliminates the programming overhead associated wit...
Page 198
6-8 3266,%/((55256 if the host attempts to build a touchkey that overlaps an already existing touchkey, the previous touchkey is cleared before the new one is built. Omitting and or setting them both to 1 in this command constitutes a clear touchkey command. If this command changes a touchkey that i...
Page 199
6-9 &ohdu7rxfknh\&rppdqg^)&7.`5hprwh the clear touchkey command reverses the effect of a previous build touchkey command. While touch cells are grouped as a larger touchkey, changing the attributes of the touchkey only affects the attributes stored at the master cell. All other touch cells retain th...
Page 200
6-10 7rxfknh\7\sh&rppdqg^)7.7`5hprwh the touchkey type command specifies how the tcs controls a touchkey. Each type can take on one of the following values: • dead: the touchkey does not generate a touch report when touched. A touchkey programmed as dead acts as if there were no touch-sensitive area...
Page 201
6-11 3266,%/((55256 if the type of the touchkey that is currently being pressed is changed and a visual response is in progress for the touchkey, the visual response is prematurely terminated. If the type of the touchkey that is currently being pressed is changed and the key was auto- repeating, aut...
Page 202
6-12 7rxfknh\9lvxdo([whqw&rppdqg^)7.9(-`5hprwh the touchkey visual extent command specifies the portion of a touchkey that automatically responds visually when activated by the user. Each visual extent can take on one of the following values: • border: the border is the portion of the touchkey compo...
Page 203
6-13 23(5$72586$*( none. (this is a remote command only.) +26786$*( [3;;u is a numeric parameter that specifies the touchkey whose visual extent is to be assigned. If is 0 or omitted, the visual extents of all touchkeys are set as specified in this command. Is a selective parameter that indicates th...
Page 204
6-14 7rxfknh\$xgleoh$wwulexwh&rppdqg^)7.$$`5hprwh the touchkey audible attribute command specifies whether the tcs beeps when a touchkey is activated by the user. Each touchkey can be assigned one of two audible attributes: • silent: the tcs does not beep when the touchkey specified within this comm...
Page 205
6-15 +26786$*( [1;;u is a selective parameter that specifies the audible attribute being assigned to the touchkey. If is 0 or omitted, the audible attribute is silent. If is 1, the audible attribute is beep. Is a numeric parameter that specifies the touchkey whose audible attribute is being assigned...
Page 206
6-16 $xwr5hshdw5dwh&rppdqg^)$55`5hprwh the auto-repeat rate command allows the host to set the auto-repeat rate for touchkey reporting. The auto-repeat rate is the rate at which touch reports are sent (or made available) to the host when a touchkey is pressed continuously. The auto-repeat rate can b...
Page 207
6-17 (;$03/(6 [2;3u the auto-repeat rate is set to 0.3 seconds. [2;100u the auto-repeat rate is set to 10 seconds. [2u auto-repeating is disabled..
Page 208
6-18 3roohg7rxfk0rgh&rppdqg^)370`5hprwh the polled touch mode command selects the polled touch mode, which causes the tcs to report touchkey closures only when requested (polled) by the host. The polled touch mode prevents data overruns and lost characters when the tcs is used with a host that has a...
Page 209
6-19 +26786$*( [>1l resets polled touch mode (to off). (the terminator for the reset command is the letter "l," ascii 6c hex.) [>1h sets polled touch mode (to on)..
Page 210
6-20 5hdg7rxfknh\6wdwxv&rppdqg^)57.6`5hprwh the read touchkey status command requests the tcs to send a touch report for the last touchkey touched but not yet reported. This command is used when the tcs is operating in the polled touch mode (when the polled touch mode is set to on). Specifically, th...
Page 211
6-21 means that no matter what touch cell is pressed within a toggle touchkey, the toggle state is altered for the master cell. Only a single toggle state exists for any touchkey. • the touchkey number of a press and release touch key the host can read the status of any toggle touchkey and determine...
Page 212
6-22 ([whqghg5hsruw0rgh&rppdqg^)(50`5hprwh the extended report mode can be reset or set using the reset mode or set mode command. When the extended report mode is reset, touch reports contain only the touchkey number, with no information about the current state of the touchkey. When the extended rep...
Page 213
6-23 (;$03/(6 a touch report that occurs when the extended report mode is reset appears as follows: [>2;042n the same touch report with the extended report mode set might appear as: [>2;042;1n this string indicates that touchkey 42 is toggled on..
Page 214
6-24 7rxfk3dqho/rfnrxw0rgh&rppdqg^)7/0`5hprwh the touch panel lockout mode command controls the touch panel lockout mode, which allows the host to lock out user input from the touch panel. This command does not affect the optional keyboard. • when the touch panel lockout mode is reset, input is allo...
Page 215: 5(*,21&200$1'6
6-25 5(*,21&200$1'6 region commands provide a simple way for the programmer to create visual touch targets on the display. Region commands outline or erase a defined area on the screen, and modify the attributes of characters and lines within a defined area. The region commands are: • outline a touc...
Page 216
6-26 2xwolqhd7rxfknh\&rppdqg^)27.`5hprwh the outline a touchkey command creates the visual border for a touchkey. The position of the cursor is not changed when this command is executed. The area of the display affected by this command is restricted to the scrolling region if the origin mode is set....
Page 217
6-27 this command assumes that the static special character font will be mapped into the extended character set when the screen is displayed. Otherwise, the box characters used to draw the outline may appear different than described above. The boxtypes used by this command can be customized by using...
Page 218
6-28 2xwolqhd5hjlrq&rppdqg^)25`5hprwh the outline a region command places a border around an area of the screen defined relative to the cursor, thereby drawing a touch target. This is convenient when a visual target does not correspond exactly with the physical boundaries of a touchkey. The position...
Page 219
6-29 +26786$*( [6;;;t is a numeric parameter from 0 through 24, which designates the height of the region in lines. If is 0, omitted, or greater than 24, a region with a height of 24 lines is defined. Is a numeric parameter from 0 through 80, which designates the width of the region in columns. If i...
Page 220
6-30 &xvwrp2xwolqhd7rxfknh\&rppdqg^)&27.`5hprwh the custom outline a touchkey command places a customized border around a touchkey. The command must include a starting character value in the character set to specify where to get the border to be used for outlining. The area of the display affected b...
Page 221
6-31 note undesirable results may be produced if the custom outline a touchkey command is executed on a touchkey that contains mixed line types. If the touchkey specified in this command designates a touch cell within a touchkey (but not the master cell), an outline is drawn around that touch cell r...
Page 222
6-32 &xvwrp2xwolqhd5hjlrq&rppdqg^)&25`5hprwh the custom outline a region command allows a customized border to be placed around a rectangular area of the screen. The command must include a starting character value that specifies where to get the border to be used for outlining. The region of the dis...
Page 223
6-33 23(5$72586$*( none. (this is a remote command only.) +26786$*( [4;;;x is a numeric parameter from 0 through 24 that designates the height of the region in lines. If is 0, omitted, or greater than 24, a region with a height of 24 lines is defined. Is a numeric parameter from 0 through 80 that de...
Page 224
6-34 0rgli\&kdudfwhu$wwulexwhvlqd7rxfknh\&rppdqg^)0&$,7.`5hprwh the modify character attributes in a touchkey command causes the character attributes within a touchkey to be modified on a touchkey basis, rather than character-by-character. This command assigns to the designated touchkey the characte...
Page 225
6-35 +26786$*( [7;;u is a numeric parameter that specifies the touchkey whose character attributes are to be modified. If is 0 or omitted, the entire screen is modified. Is a selective parameter that designates the visual extent of the touchkey to be affected by the command. If is 0 or omitted, the ...
Page 226
6-36 0rgli\&kdudfwhu$wwulexwhvlqd5hjlrq&rppdqg^)0&$,5`5hprwh the modify character attributes in a region command causes the character attributes within a defined region to be modified on a regional basis, rather than character-by-character. This command assigns to the designated region the attribute...
Page 227
6-37 • if the region does not contain any double-width or double-size lines, the region is assumed to be composed of all normal lines. 23(5$72586$*( none. (this is a remote command only.) +26786$*( [7;;;t is a numeric parameter from 0 through 24 that designates the height of the region in lines. If ...
Page 228
6-38 5hyhuvh&kdudfwhu$wwulexwhvlqd7rxfknh\&rppdqg^)5&$,7.`5hprwh the reverse character attributes in a touchkey command allows the host to quickly change the character attributes within a touchkey. The attributes to be changed with this command are specified within the command. One or more attribute...
Page 229
6-39 +26786$*( [9;;;;...;u is a numeric parameter that specifies the touchkey whose character attributes are to be reversed. If is 0 or omitted, the character attributes of the entire screen are reversed. Pv> is a selective parameter that specifies the visual extent of the touchkey to be reversed. I...
Page 230
6-40 5hyhuvh&kdudfwhu$wwulexwhvlqd5hjlrq&rppdqg^)5&$o5`5hprwh the reverse character attributes in a region command allows the host to quickly reverse character attributes within a region. The attributes to be changed with this command are specified within the command. One or more attributes can be c...
Page 231
6-41 • if the region does not contain any double-width or double-size lines, the region is assumed to be composed of all normal lines. Note undesirable results may be produced if the reverse character attributes in a region command is executed on a region that contains mixed line types. 23(5$72586$*...
Page 232
6-42 (;$03/(6 [9;;;;5t reverses the blink attribute for the entire screen. [9;12;51;2;4;1t reverses the highlight and underline attributes in the border of a 12 line by 51 column region with upper left corner at the cursor. [9;1;50;1;8t reverses the conceal attribute in the inner part of a 1 line by...
Page 233
6-43 )lood7rxfknh\:lwkd&kdudfwhu&rppdqg^))7.&`5hprwh the fill a touchkey with a character command allows the host to easily fill a touchkey with a character. The character specified in this command will be repeatedly displayed in each character position throughout the visual extent of the touchkey t...
Page 234
6-44 is a numeric parameter that specifies the decimal value of the character to be used for filling the area specified. If is omitted, the default value 251 from within the extended character set is used (the gray block character when the static special character font is mapped into the extended ch...
Page 235
6-45 )lood5hjlrq:lwkd&kdudfwhu&rppdqg^))5&`5hprwh the fill a region with a character command allows the host to easily fill a rectangular area with a specified character. The upper left corner of the region is defined by the current cursor position. The character specified in this command is repeate...
Page 236
6-46 if is 0, omitted, or greater than 80, a region 80 columns wide is defined. Is a selective parameter that specifies the visual extent of the region to be filled. If is 0 or omitted, all of the region is filled. If is 1, only the inner portion of the region is filled. If is 2, only the border of ...
Page 237
6-47 (udvhd7rxfknh\&rppdqg^)(7.`5hprwh the erase a touchkey command is sent by the host to erase the target associated with a specified touchkey on the display. Each character that is erased is replaced by a blank (a space character). The attribute of each character position in the erased touchkey r...
Page 238
6-48 3266,%/((55256 undesirable results may be produced if the erase a touchkey command is executed on a touchkey that contains mixed line types. (;$03/(6 [8u erases the entire screen (if origin mode is reset and the cursor is in the home position). [8;53;2u erases the border of touchkey 53..
Page 239
6-49 (udvhd5hjlrq&rppdqg^)(5`5hprwh the erase a region command is sent by the host to erase a designated area of the screen. Each character that is erased is replaced by a blank (a space character). The attribute of each character position in the erased region reverts to off, unless the nochange att...
Page 240
6-50 +26786$*( [8;;;t is a numeric parameter from 0 through 24, which designates the height of the region in lines. If is 0, omitted, or greater than 24, a region with a height of 24 lines is defined. Is a numeric parameter from 0 through 80, which designates the width of the region in columns. If i...
Page 241: ,1752'8&7,21
7-1 &+$37(5352*5$00,1*7+(237,21$/.( ,1752'8&7,21 this chapter describes how to program the optional keyboard. Topics include: • a description of the keyboard • a list of the codes the keyboard transmits to the host • a description of the commands that affect the keyboard’s operation .( the optional ...
Page 242
7-2 the space bar normally moves the cursor one space to the right, leaving an invisible space character in its place. The scroll lock key is a toggle. The first press freezes the display by causing the tcs to stop processing codes. The second press allows the tcs to resume processing codes. If the ...
Page 243
7-3 7kh6hw8s.H\ the set up key does not transmit anything to the host computer. It is used to call up the setup screen, and to exit the setup, test, and alignment screens. See using the setup screen, for more information. &xuvru&rqwuro.H\v the cursor control keys transmit ansi cursor control sequenc...
Page 244
7-4 7deoh&rghv6hqwe\.H\vzkhq3uhvvhgzlwkwkh&wuo.H\ .( &75/.( &2'(6(1772+267+(;$'(&,0$/ 01(021,& ru6sdfh%du $ % & ' ( ) * + , - . / 0 1 2 3 4 5 6 7 8 9 : ;ru'hohwh = ru> ru? Ru@ ruc ru $ % & 'ru'$ ( ) $ % & ' ( ) ) 18//! 62+! 67;! (7;! (27! (14! $&.! %(/! %6! +7! /)! 97! ))! &5!Ru&5!/)! 62! 6,! '/(! '...
Page 245
7-5 7deoh&xuvru&rqwuro.H\&rghv .( &21752/6(48(1&( 6(1772+267 $&7,217$.(1,)(&+2('727+(7&6 Æ Ç Å Ä (6&!>$ (6&!>% (6&!>& (6&!>' 0ryhvwkhfxuvrurqholqhxs 0ryhvwkhfxuvrurqholqhgrzq 0ryhvwkhfxuvrurqhvsdfhwrwkhuljkw 0ryhvwkhfxuvrurqhvsdfhwrwkhohiw the cursor control keys normally move the cursor on the scre...
Page 246
7-6 7deoh6shfldo)xqfwlrq.H\&rghv .( &2'(6(48(1&(6(1772+267 ) ) ) ) ) ) ) ) ) ) 6kliw) 6kliw) 6kliw) 6kliw) 6kliw) 6kliw) 6kliw) 6kliw) 6kliw) 6kliw) &wuo) &wuo) &wuo) &wuo) &wuo) &wuo) &wuo) &wuo) &wuo) &wuo) (6&!>a (6&!>a (6&!>a (6&!>a (6&!>a (6&!>a (6&!>a (6&!>a (6&!>a (6&!>a (6&!>a (6&!>a (6&!>a ...
Page 247
7-7 7deoh$x[loldu\.H\sdg&rghv .( 180(5,&&2'(66(1772+267 $33/,&$7,21&2'(66(1772+267 ¶ (qwhu 3) 3) 3) 3) µ &5!Ru&5!/)! (6&!23 (6&!24 (6&!25 (6&!26 (6&!2s (6&!2t (6&!2u (6&!2v (6&!2w (6&!2x (6&!2y (6&!2z (6&!2[ (6&!2\ (6&!2p (6&!2o (6&!2q (6&!20 (6&!23 (6&!24 (6&!25 (6&!26 7kh1hz/lqh0rghghwhuplqhvzklfk...
Page 248
7-8 .( the keyboard commands affect the operation of the optional keyboard. The keyboard commands are: • keyboard lockout mode command (remote) • keypad mode command (remote) • local/remote mode command (local) • send long break command (local) • local/remote mode command (local) • send short break ...
Page 249
7-9 .H\erdug/rfnrxw0rgh&rppdqg>.$0@5hprwh the keyboard lockout mode command sets and resets the keyboard lockout mode. This allows the host to block input from the keyboard. When the keyboard lockout mode is set, keyboard entries are ignored by the tcs (the keyboard is locked). Setting the keyboard ...
Page 250
7-10 .H\sdg0rgh&rppdqg>'(&.3$0@>'(&.310@5hprwh the keypad mode command sets the auxiliary keypad to either the numeric or application mode so the host can select whether the auxiliary keypad on the optional keyboard sends numeric codes or application codes to the host. When the keypad is set to the ...
Page 251
7-11 /rfdo5hprwh0rgh&rppdqg/rfdo the local/remote mode command controls whether the tcs accepts remote commands from the host computer or from the keyboard. The command sets the tcs either to the remote mode (in which the tcs accepts remote commands from the host) or to the local mode (in which the ...
Page 252
7-12 6hqg/rqj%uhdn&rppdqg/rfdo the send long break command causes the tcs to hold the rs-232-e data terminal ready (dtr) and request to send (rts) lines off (low) for approximately 3.5 seconds. This command is typically used to initiate disconnection from the host equipment, particularly with a mode...
Page 253
7-13 6hqg6kruw%uhdn&rppdqg/rfdo the send short break command causes the rs-232-e transmitted data (td) line to be held in the “0” or space state for approximately 300 milliseconds. This can be used as a special signal to the host that can be recognized at any baud rate. A typical use of the short br...
Page 254: &+$37(55(027(6(/)7(67,1*
8-1 &+$37(55(027(6(/)7(67,1* ,1752'8&7,21 this chapter describes two types of commands: • status reporting commands • remote self-test commands the status reporting commands report the status of the touch control screen (tcs). The remote self-test commands activate and report the results of self-tes...
Page 255: 67$7865(3257,1*&200$1'6
8-2 67$7865(3257,1*&200$1'6 status reporting commands allow the host to determine the operational status of the tcs. The status reporting commands are: • power-up interrupt mode command (remote) • request power status command (remote) • error interrupt mode command (remote) • request error status co...
Page 256
8-3 3rzhu8s,qwhuuxsw0rgh&rppdqg^)38,0`5hprwh the power-up interrupt mode command is used to set or reset the power-up interrupt mode. When the power-up interrupt mode is set, the tcs generates an interrupt to the host after regaining power. This interrupt can be used by the host to detect whether th...
Page 257
8-4 5htxhvw3rzhu6wdwxv&rppdqg^)536`5hprwh the request power status command allows the host to determine if the tcs has lost power or was reset since the last request power status command. 23(5$72586$*( none. (this is a remote command only.) +26786$*( [>0n if the tcs has not lost power or been reset ...
Page 258
8-5 (uuru,qwhuuxsw0rgh&rppdqg^)(,0`5hprwh the error interrupt mode command is used to set or reset the error interrupt mode. When the error interrupt mode is set, the tcs generates an interrupt to the host immediately upon detecting an error. The host can use this interrupt to detect whether the ope...
Page 259
8-6 5htxhvw(uuru6wdwxv&rppdqg^)5(6`5hprwh the request error status command allows the host to poll the tcs to determine whether a new error has occurred. This command is of use only when the error interrupt mode is reset. When the error interrupt mode is set, the tcs does not hold any error status r...
Page 260
8-7 note the report may differ from the above format if the reporting format command has been issued. Refer to the reporting format command description in chapter 4 for details. 3266,%/((55256 if this command is sent while the error interrupt mode is set, the tcs always responds with an indication t...
Page 261
8-8 5htxhvw7&6,ghqwlilfdwlrq&rppdqg>'$@5hprwh the request tcs identification command allows the host to determine the following information about the tcs: • the type of tcs with which it is communicating • the firmware version installed in the tcs • the programmable options installed in the tcs 23(5...
Page 262
8-9 (;$03/( an example of a tcs identification sequence sent to the host in response to this command is: [2;10;98304;0;0;0c the tcs type is model 1030 (2), with firmware version 1.0(10) containing 96k bytes (98304) of expansion memory..
Page 263
8-10 5htxhvw7&66wdwxv&rppdqg>'65@5hprwh the request tcs status command allows the host to determine the operational status of the tcs. The tcs responds to the request tcs status command by indicating whether it has had a malfunction since it was last powered-up or reset. A malfunction is any error t...
Page 264: 5(027(6(/)7(67&200$1'6
8-11 5(027(6(/)7(67&200$1'6 the remote self-test commands activate and report on self-tests built into the tcs. These tests verify that selected parts of the tcs are operating correctly. The remote self-test commands are: • continuous integrity test command (local/remote) • request rom test report c...
Page 265
8-12 &rqwlqxrxv,qwhjulw\7hvw&rppdqg^)&o7`/rfdo5hprwh the continuous integrity test command places the tcs into the continuous integrity test, which is a continuous testing loop that verifies proper operation of the tcs electronics. The continuous integrity test command activates the following tests ...
Page 266
8-13 all checksums, addresses, data sent, data received, and failure history values are displayed in hexadecimal. All other numbers are displayed in decimal. The ram data pattern failure history contains a l in each bit position where a data error has been detected throughout the history of the cont...
Page 267
8-14 5htxhvw5207hvw5hsruw&rppdqg^)5575`5hprwh the request rom test report command allows the host to obtain detailed results of rom testing during the continuous integrity test or automatic self-testing. The host receives a response from this command when the continuous integrity test is in progress...
Page 268
8-15 5htxhvw1rqyrodwloh0hpru\7hvw5hsruw&rppdqg^)5(75`5hprwh the request nonvolatile memory test report command allows the host to obtain detailed results of nonvolatile testing during the continuous integrity test or automatic self-testing. The host receives a response from this command while the co...
Page 269
8-16 if the continuous integrity test has completed 112 loops and detected nonvolatile memory checksum errors during 23 of those test loops and the most recent cell in error was 46, the tcs responds with: [>7;112;23;46n.
Page 270
8-17 5htxhvw5$07hvw5hsruw&rppdqg^)55$75`5hprwh the request ram test report command allows the host to obtain detailed results of ram testing during the continuous integrity test or automatic self-testing. The host receives a response from this command while the continuous integrity test is in progre...
Page 271
8-18 (;$03/(6 [>8n this control string from the host requests a ram test report. If only a power-up test has been performed and no ram errors were detected, the tcs responds with: [>8;1;0;0;0;0n [>8n this continuous string from the host requests a ram test report. Assume the continuous integrity tes...
Page 272
8-19 5htxhvw7rxfk3dqho7hvw5hsruw&rppdqg^)5775`5hprwh the request touch panel test report command allows the host to obtain detailed results of touch panel testing during the continuous integrity test or automatic self-testing. The host receives a response from this command while the continuous integ...
Page 273: $33(1',;$
A-1 $33(1',;$ 6$03/(352*5$0 352*5$0'(6&5,37,21 with no modifications, the sample program in this appendix can run in basic basica*, quickbasic*, and gwbasic* on the ibm pc*, pc/xt, or pc/at or compatibles. The program sets up a communication channel between the ibm pc and the tcs, and creates three ...
Page 274
A-2 7kh6dpsoh3urjudp 100 ‘ ******************************************** 105 ‘ 110 ‘ set up constants 115 120 es$ = chr$(27) ‘ control string introducer 125 cr$ = es$ + “[c” ‘ move cursor right command 130 cd$ = es$ + “[b” ‘ move cursor down command 135 ‘ 140 dim tkey$(3) ‘ define array of touchkey 1...
Page 275
A-3 295 print #1, es$;”[12h”; ‘ local echo mode off 300 print #1, es$;”[1v”; ‘ turn off cursor 305 print #1, es$;”[3z”; ‘ display activity on 310 ‘ 315 ‘ set up tcs character sizes and touch panel 320 ‘ 325 print #1, es$;”[1;1h”; ‘ position cursor 330 print #1, es$;”#2”; ‘ double-sized line 335 ‘ 34...
Page 276
A-4 505 ‘************************************************ 510 ‘ 515 ‘ draw rest of display 520 ‘ 525 print #1, es$;”[1;11h”; ‘ position cursor 530 print #1, “touch control screen”; ‘ top of double-sized line 535 print #1, es$;”#2; ‘ copy to bottom half. 540 ‘ 545 print #1, es$;”[5;3h”; ‘ position cu...
Page 277: $33(1',;%
B-1 $33(1',;% &200$1'6800$5 ,1752'8&7,21 this appendix contains a table that summarizes all tcs commands and provides commonly needed information about each command. Commands listed here are fully documented in the indicated chapters of this manual. The command summary table groups the commands acco...
Page 278
B-2 7deoh%6xppdu\ri7&6&rppdqgv*urxshg$ffruglqjwr5hodwhg)xqfwlrqv &200$1'01(021,& +26786$*(7&65(63216( 7&60rgh&rppdqgv 5hvhw0rgh>50 @ )ru$16,vshflilhgprghv (6&!>3v!3v!O )ru'(&sulydwhprghv (6&!>"3v!3v!O )ru7&6sulydwhprghv (6&!>!3v!3v!O 6hw0rgh>60@ )ru$16,vshflilhgprghv (6&!>3v!3v!K )ru'(&sulydwhprghv ...
Page 279
B-3 7deoh%6xppdu\ri7&6&rppdqgv*urxshg$ffruglqjwr5hodwhg)xqfwlrqv frqwlqxhg &200$1'01(021,& +26786$*(7&65(63216( &rppxqlfdwlrq&rppdqgv 5hsruwlqj)rupdw^)5)` (6&!>3!3!3!Z 3!)luvwlqwurgxfhu )luvwlqwurgxfhu'hidxow (6&!Ghflpdo 3!6hfrqglqwurgxfhu 6hfrqglqwurgxfhu'hidxow >ghflpdo 3!7huplqdwru 7huplqdwru'hid...
Page 280
B-4 7deoh%6xppdu\ri7&6&rppdqgv*urxshg$ffruglqjwr5hodwhg)xqfwlrqv frqwlqxhg &200$1'01(021,& +26786$*(7&65(63216( 6fuhhq0hpru\&rppdqgv 5hdg6fuhhq0hpru\5hpdlqlqj ^)5605` (6&!>!Q 7&65hvsrqvh (6&!>!3vx!3ex!3vu!3eu!Q 3vx!Qxpehurivfuhhqvlqxvh 3ex!E\whvrivfuhhqphpru\lqxvh 3vu!Qxpehurivfuhhqvuhpdlqlqjwrehxvh...
Page 281
B-5 7deoh%6xppdu\ri7&6&rppdqgv*urxshg$ffruglqjwr5hodwhg)xqfwlrqv frqwlqxhg &200$1'01(021,& +26786$*(7&65(63216( &kdudfwhu6hwdqg&kdudfwhu)rqw&rppdqgv &rs\&kdudfwhu)rqw^)&&)` (6&!>3vuf!3ghvw!` 3vuf! Rplwwhg 6wdwlf$6&,,&kdudfwhu)rqw '\qdplf&kdudfwhu)rqw '\qdplf&kdudfwhu)rqw 6wdwlf6shfldo&kdudfwhu)rqw 3...
Page 282
B-6 7deoh%6xppdu\ri7&6&rppdqgv*urxshg$ffruglqjwr5hodwhg)xqfwlrqv frqwlqxhg &200$1'01(021,& +26786$*(7&65(63216( &kdudfwhu'lvsod\lqj&rppdqgv 'lvsod\'rxeoh:lgwk/lqh '(&':/ (6&! 'lvsod\'rxeoh6l]h/lqh'(&'+/ (6&! 3odfh'rxeoh6l]h/lqh^)'6/` (6&! 'lvsod\1rupdo/lqh'(&6:/ (6&! 'udz%du)ru%du&kduw^)'%%` (6&!>3v...
Page 283
B-7 7deoh%6xppdu\ri7&6&rppdqgv*urxshg$ffruglqjwr5hodwhg)xqfwlrqv frqwlqxhg &200$1'01(021,& +26786$*(7&65(63216( &kdudfwhu'lvsod\lqj&rppdqgv (udvhlq'lvsod\>('@ (6&!>3v!- 3v! Rplwwhg hudvhiurpfxuvruwkurxjkhqg hudvhiurpvwduwwkurxjkfxuvru hudvhwkhhqwluhvfuhhq &kdudfwhu,qwhusuhwdwlrq&rppdqgv $xwr:uds$urx...
Page 284
B-8 7deoh%6xppdu\ri7&6&rppdqgv*urxshg$ffruglqjwr5hodwhg)xqfwlrqv frqwlqxhg &200$1'01(021,& +26786$*(7&65(63216( &kdudfwhu,qwhusuhwdwlrq&rppdqgv 6hw&kdudfwhu$wwulexwhv>6*5@ (6&!>3v!3v!P 3v! Rplwwhg doorii kljkoljkw wxuqriikljkoljkw xqghuolqh wxuqriixqghuolqh eolqn wxuqriieolqn uhyhuvhylghr wxuqriiuhy...
Page 285
B-9 7deoh%6xppdu\ri7&6&rppdqgv*urxshg$ffruglqjwr5hodwhg)xqfwlrqv frqwlqxhg &200$1'01(021,& +26786$*(7&65(63216( &xuvru&rppdqgv 0ryh&xuvruwr$evroxwh3rvlwlrq >&83@ (6&!>3o!3f!+ >+93@ (6&!>3o!3f!I 3o! Rplwwhg olqh q olqhq 3f! Rplwwhg froxpq q froxpqq 0ryh&xuvruwr7rxfknh\ ^)0&77.` (6&!>!3n!+ 3n! Rplwwhg...
Page 286
B-10 7deoh%6xppdu\ri7&6&rppdqgv*urxshg$ffruglqjwr5hodwhg)xqfwlrqv frqwlqxhg &200$1'01(021,& +26786$*(7&65(63216( &xuvru&rppdqgv 5hyhuvh,qgh[>5,@ (6&!0ru5,! 5hdg&xuvru3rvlwlrq>&35@ (6&!>q 7&65hvsrqvh (6&!>3o!3f!5 3o! Uhodwlyholqhqxpehurifxuvru,i2uljlq 0rghlvvhwolqholvdwwkhwrsrivfuroolqjuhjlrqli 2uljl...
Page 287
B-11 7deoh%6xppdu\ri7&6&rppdqgv*urxshg$ffruglqjwr5hodwhg)xqfwlrqv frqwlqxhg &200$1'01(021,& +26786$*(7&65(63216( &xuvru&rppdqgv 7&65hvsrqvh frqwlqxhg frqfhdodfwlyh frqfhdolqdfwlyh &roru7&65hvsrqvh (6&!>!3kl!3xo!3eolqn!3uy!3frqfo!3ij!3ej!3ff!Q 3ij! Fxuuhqwiruhjurxqgfroru 3ej! Fxuuhqwedfnjurxqgfroru 3...
Page 288
B-12 7deoh%6xppdu\ri7&6&rppdqgv*urxshg$ffruglqjwr5hodwhg)xqfwlrqv frqwlqxhg &200$1'01(021,& +26786$*(7&65(63216( 7rxfk3dqho&rppdqgv %xlog7rxfknh\^)%7.` (6&!>3n!3k!3z!X 3n! Rplwwhg fohdudoowrxfknh\v q qxpehuripdvwhufhoolqwrxfknh\ 3k! Rplwwhg q khljkwlqwrxfkfhoov 3z! Rplwwhg q zlgwklqwrxfkfhoov &ohdu7...
Page 289
B-13 7deoh%6xppdu\ri7&6&rppdqgv*urxshg$ffruglqjwr5hodwhg)xqfwlrqv frqwlqxhg &200$1'01(021,& +26786$*(7&65(63216( 7rxfk3dqho&rppdqgv 7rxfknh\9lvxdo([whqw^)7.9(` (6&!>3n!3y!X 3n! Rplwwhg vhwdoowrxfknh\v q wrxfknh\zkrvhh[whqwlvehlqjdvvljqhg 3y! Rplwwhg qrylvxdouhvsrqvhzkhqsuhvvhg uhyhuvhylghrlqqhufkdud...
Page 290
B-14 7deoh%6xppdu\ri7&6&rppdqgv*urxshg$ffruglqjwr5hodwhg)xqfwlrqv frqwlqxhg &200$1'01(021,& +26786$*(7&65(63216( 7rxfk3dqho&rppdqgv 7&65hvsrqvh frqwlqxhg qrwrxfkhvwruhsruw qqq wrxfknh\qxpehu 3v! Nh\lvwrjjohgrii nh\lvwrjjohgrq ([whqghg5hsruw0rgh^)(50` (6&!>!Ouhvhw (6&!>!Kvhw 7rxfk3dqho/rfnrxw0rgh^)7/...
Page 291
B-15 7deoh%6xppdu\ri7&6&rppdqgv*urxshg$ffruglqjwr5hodwhg)xqfwlrqv frqwlqxhg &200$1'01(021,& +26786$*(7&65(63216( 5hjlrq&rppdqgv 2xwolqhd5hjlrq^)25` frqwlqxhg %r[w\sherughu %r[w\sherughu %r[w\sherughu &xvwrp2xwolqhd7rxfknh\ ^)&27.` (6&!>3n!3fk![ 3n! Rplwwhg rxwolqhhqwluhvfuhhq q wrxfknh\qxpehuwrrxwol...
Page 292
B-16 7deoh%6xppdu\ri7&6&rppdqgv*urxshg$ffruglqjwr5hodwhg)xqfwlrqv frqwlqxhg &200$1'01(021,& +26786$*(7&65(63216( 5hjlrq&rppdqgv 0rgli\&kdudfwhu$wwulexwhvlqd 5hjlrq^)0&$,5` (6&!>3o!3f!3y!W 3o! Rplwwhg q olqhvlquhjlrqiurpfxuvrugrzq 3f! Rplwwhg q froxpqvlquhjlrqiurpfxuvruwruljkw 3y! Rplwwhg prgli\doofk...
Page 293
B-17 7deoh%6xppdu\ri7&6&rppdqgv*urxshg$ffruglqjwr5hodwhg)xqfwlrqv frqwlqxhg &200$1'01(021,& +26786$*(7&65(63216( 5hjlrq&rppdqgv 5hyhuvh&kdudfwhu$wwulexwhvlq 5hjlrq^)5&$,5` (6&!>3o!3f!3y!3d!3d!W 3o! Rplwwhg q olqhvlquhjlrqiurpfxuvrugrzq 3f! Rplwwhg q froxpqvlquhjlrqiurpfxuvruwruljkw 3y! Rplwwhg uhyhu...
Page 294
B-18 7deoh%6xppdu\ri7&6&rppdqgv*urxshg$ffruglqjwr5hodwhg)xqfwlrqv frqwlqxhg &200$1'01(021,& +26786$*(7&65(63216( 5hjlrq&rppdqgv )lood5hjlrq:lwkd&kdudfwhu ^))5&` (6&!>3o!3f!3y!3fk![ 3o! Rplwwhg q olqhvlquhjlrqiurpfxuvrugrzq 3f! Rplwwhg q froxpqvlquhjlrqiurpfxuvruwruljkw 3y! Rplwwhg iloodoofkdudfwhuv ...
Page 295
B-19 7deoh%6xppdu\ri7&6&rppdqgv*urxshg$ffruglqjwr5hodwhg)xqfwlrqv frqwlqxhg &200$1'01(021,& +26786$*(7&65(63216( 5hjlrq&rppdqgv (udvhd5hjlrq^)(5` frqwlqxhg 3y! Rplwwhg hudvhdoofkdudfwhuvlquhjlrq hudvhlqqhufkdudfwhuv hudvherughufkdudfwhuv .H\erdug&rppdqgv .H\erdug/rfnrxw0rgh>.$0@ (6&!>ouhvhw (6&!>kvh...
Page 296
B-20 7deoh%6xppdu\ri7&6&rppdqgv*urxshg$ffruglqjwr5hodwhg)xqfwlrqv frqwlqxhg &200$1'01(021,& +26786$*(7&65(63216( 5hjlrq&rppdqgv 7&65hvsrqvh frqwlqxhg ([sdqvlrq0hpru\)xoohuuru ([sdqvlrq0hpru\8qlqlwldol]hghuuru 5htxhvw7&6,ghqwlilfdwlrq>'$@ (6&!>f (6&!>f 7&65hvsrqvh (6&!>3w!3y!3p!3g!3z! 3r!F 3w! 7&6 7&...
Page 297
B-21 7deoh%6xppdu\ri7&6&rppdqgv*urxshg$ffruglqjwr5hodwhg)xqfwlrqv frqwlqxhg &200$1'01(021,& +26786$*(7&65(63216( 5hprwh6hoi7hvw&rppdqgv 5htxhvw5207hvw5hsruw^)5575` (6&!>!Q 7&65hvsrqvh (6&!>!3orrsv!3idlo!3vxp!Q 3orrsv! 1xpehuri520fkhfnvxpwhvwvfrpsohwhgvlqfhwkh&rqwlqxrxv,qwhjulw\ 7hvwvwduwhgruvlqfhodv...
Page 298
B-22 7deoh%6xppdu\ri7&6&rppdqgv*urxshg$ffruglqjwr5hodwhg)xqfwlrqv frqwlqxhg &200$1'01(021,& +26786$*(7&65(63216( 5hprwh6hoi7hvw&rppdqgv 7&65hvsrqvh frqwlqxhg 'hflpdohtxlydohqwriwkhodvwidlohgdgguhvv,iqrhuuruvzhuhghwhfwhg 3huuru! 'hflpdohtxlydohqwriwkhgdwdydoxhvhqwwrwkhodvwidlohgdgguhvv h[foxvlyh25hgz...
Page 299: $33(1',;&
$33(1',;& &86720&+$5$&7(5)2176 ,1752'8&7,21 the static character fonts supplied with the tcs (which provide the default contents for the standard and extended character sets) can be customized by the designer. This appendix describes the static character fonts and explains how they can be modified. ...
Page 300
7deoh&6wdwlf$6&,,&kdudfwhu)rqw note: in this table, the value of a character in hex can be determined by its row and column position. The column number represents the 16’s digit and the row number represents the 1’s. For example, character g is specified as column 4, row 7. Therefore, the value of c...
Page 301
7deoh&6wdwlf6shfldo&kdudfwhu)rqw note: in this table, the value of a character in hex can be determined by its row and column position. The column number represents the 1’s. For example, character ‘a’ is specified as column a, row b. Therefore, the value of character ‘a’ is ab hex. The shaded charac...
Page 302: &+$5$&7(5'(6&5,37,21
&uhdwlqj&xvwrp&kdudfwhuv8vlqj6riwzduhru)lupzduh it may not be necessary to read further in this appendix if only a few special characters are needed. The programmer may find it easier to down-line load them into the dynamic character fonts rather than modify the firmware. The information in this app...
Page 303
'hvfulswlrq2i6wdwlf&kdudfwhu)rqwv together, the two character fonts of the tcs contain 256 characters. Complete descriptions of the fonts, the standard usage of their characters, and the consequences of changing a character are shown in tables c-3 and c-4. Many locations within the static character ...
Page 304
7deoh&&rqvhtxhqfhvri&kdqjlqjwkh6wdwlf6shfldo&kdudfwhu)rqw3520 &+$5$&7(5,1 +(; 127( 67$1'$5'86$*( &216(48(1&(6,)&+$1*(' %r[w\sh 7rxfknh\dqguhjlrqrxwolqhfrppdqg xvhfxvwrpfkdudfwhuviru%r[w\sho ) %r[w\sh 7rxfknh\dqguhjlrqrxwolqhfrppdqg xvhfxvwrpfkdudfwhuviru%r[w\sh %r[w\sh 7rxfknh\dqguhjlrqrxwolqhfrppdq...
Page 305
7deoh&&rqvhtxhqfhvri&kdqjlqjwkh6wdwlf6shfldo&kdudfwhu)rqw3520 frqwlqxhg )) 5hvhuyhge\$16,1rwglvsod\hg h[fhswlq6wdwlf6shfldo&kdudfwhu )rqw7hvwdqg&rppxqlfdwlrq 0rqlwru 7khfrghzlooehglvsod\hgxvlqjwkh fxvwrpfkdudfwhuzlwklqwkh6wdwlf 6shfldo&kdudfwhu)rqw7hvwdqgwkh &rppxqlfdwlrq0rqlwru 127(6 &rghvryhuo\lqj...
Page 306: +2:&+$5$&7(56$5(6725('
+2:&+$5$&7(56$5(6725(' characters displayed on the tcs consist of character cells. A character cell is a portion of the display 8 pixels wide by 10 pixels high. These pixels are turned on or off by the data contained in the character set. Since every pixel in each character cell can be displayed, gr...
Page 307
Character’s ascii code start address dot pattern decode display character font eprom h (48 hex) 480 not used 480 481 482 483 484 485 486 487 488 489 48a 00 82 82 82 fe 82 82 82 00 00 xx )ljxuh&'lvsod\&kdudfwhu$gguhvvlqj &kdudfwhu6l]hv the standard ascii display characters are designed according to t...
Page 308
• lowercase letters with descenders have the body of the character 4 pixels high by 7 pixels wide with a 3-pixel high descender. Letters with descenders extend to the bottom of the character cell. The leftmost side of the character region is justified to the left column of pixels in the character ce...
Page 309: 3,;(/'$7$
3,;(/'$7$ the following diagrams are for reference to the contents of the static ascii and static special character fonts. This information can be used to design custom character fonts. The aspect ratio of the character representations was altered slightly to give a close approximation of the displa...
Page 314
Ascii code custom character pattern chart ascii code ascii code ascii code.
Page 315: $33(1',;'
D-1 $33(1',;' ,1&$6(2)',)),&8/7 ,1752'8&7,21 this appendix describes common tcs programming and operating problems. Most topics are covered in the command reference information, but are restated here because many common programming difficulties result from incorrect combinations of modes and command...
Page 316
D-2 7deoh'6\pswrp6roxwlrq&kduw 6 3266,%/(&$86( 62/87,216 &rppxqlfdwlrq3ureohpv &rppxqlfdwlrqvhuuruvlq 2shudwlrqdo6wdwxv:lqgrz 7&6dqgkrvwfrppxqlfdwlrqv sdudphwhuvgrqrwpdwfk &kdqjhfrppxqlfdwlrqvsdudphwhuviru 7&6rukrvw ;21;2))0rghlvriivr7&6fdqqrw vwdoowkhkrvwuhvxowlqjlq frppxqlfdwlrqvexiihuryhuiorzdqgo...
Page 317
D-3 6\pswrp6roxwlrq&kduw frqwlqxhg 6 3266,%/(&$86( 62/87,216 &rppxqlfdwlrq3ureohpv 7&6lqfruuhfwo\lqwhusuhwv krvwfrppdqgvgxulqjxvhu lqsxw +rvwlvhfkrlqjxvhulqsxwedfnwrwkh 7&6wkhuhe\lqwhuuxswlqjdqgfruuxswlqj frqwurovhtxhqfhvehlqjvhqwwrwkh7&6 'lvdeohhfkrlqje\wkhkrvwdqgxvhorfdo hfkrlqvwhdg 25 6wdoodqgxqv...
Page 318
D-4 6\pswrp6roxwlrq&kduw frqwlqxhg 6 3266,%/(&$86( 62/87,216 7rxfk3ureohpv 7rxfknh\vqhyhuvhqg wrxfkuhsruw $oowrxfknh\vsurjudpphgdvghdg 8vh7rxfknh\7\shfrppdqgwrfkdqjh wrxfknh\w\shv 25 (qwhu6hwxs6fuhhqdqgshuirupdvriw uhvhwvhh127(diwhuwdeoh 7rxfksdqhoidlohggxulqjwrxfksdqho whvwdqgzdvdxwrpdwlfdoo\orfnhg...
Page 319
D-5 6\pswrp6roxwlrq&kduw frqwlqxhg 6 3266,%/(&$86( 62/87,216 'lvsod\3ureohpv 6fuhhqgrhvqwoljkw 'lvsod\dfwlylw\vdyhgdvrii (qwhu6hwxs6fuhhqdqgfkdqjhglvsod\ dfwlylw\wrrqruwlphrxw &rqfhdodwwulexwhvhwryhuwkhhqwluh glvsod\ (qwhu6hwxs6fuhhqdqgshuirupdvriw uhvhwvhh127(diwhuwdeoh .H\erdug/rfnrxw0rghvhw 5hvhw...
Page 320
D-6 6\pswrp6roxwlrq&kduw frqwlqxhg 6 3266,%/(&$86( 62/87,216 'lvsod\3ureohpv $wwulexwhvfkdqjhhyhq zkhq12&+$1*($wwulexwh 0rghvhw 1rupdorshudwlrq'luhfwo\frppdqghg dwwulexwhfkdqjhvduhxqdiihfwhge\ 12&+$1*($wwulexwh0rgh 6hh12&+$1*($wwulexwh0rgh ghvfulswlrqlq&kdswhu &rqfhdodwwulexwhvhw 7xuqriifrqfhdodwwul...
Page 321
D-7 6\pswrp6roxwlrq&kduw frqwlqxhg 6 3266,%/(&$86( 62/87,216 'lvsod\3ureohpv &rqfhdohgfkdudfwhuv glvsod\lqgliihuhqwfroru wkdqvfuhhqedfnjurxqg &rqfhdofrorugliihuhqwwkdqfxuuhqw edfnjurxqgfroruzkhqfkdudfwhuvzlwk frqfhdodwwulexwhduhglvsod\hg 0dnhfrqfhdofrorudqgedfnjurxqg froruwkhvdph 6wruhg6fuhhq3ureohp...
Page 322: &20021352*5$00,1*352%/(06
D-8 &20021352*5$00,1*352%/(06 the most common programming problems are associated with the following topics: • polled touch mode / read touchkey status command • reporting format / end of line character • origin mode / scrolling region • nochange attribute mode / modify attribute commands • conceal ...
Page 323
D-9 ,qwhudfwlrq%hwzhhq3roohg7rxfk0rghdqgwkh5hdg7rxfknh\6wdwxv &rppdqg the host application program can get touch reports from the tcs as follows: • the tcs can send them spontaneously • the host can poll the tcs for them any given application program should use only one of these methods; polled touc...
Page 324
D-10 ,qwhudfwlrq%hwzhhq5hsruwlqj)rupdwdqgwkh(qg2i/lqh&kdudfwhu the reporting format command enables the following three characters to be changed in tcs reports: the first introducer character (default is ). The second introducer character (default is left bracket: [). The appended terminator charact...
Page 325
D-11 ,qwhudfwlrq%hwzhhq2uljlq0rghdqg6furoolqj5hjlrq the interaction between the setting of the origin mode and a scrolling region can produce unexpected results. Note the following points: • setting origin mode repositions the cursor to row l, column 1 of the current scrolling region. Resetting orig...
Page 326
D-12 • a scrolling region acts like a smaller independent screen when origin mode is set. • setting origin mode moves the cursor to the home position of the current scrolling region. Lines are numbered relative to the top of the scrolling region. • resetting origin mode moves the cursor to the home ...
Page 327
D-13 ,qwhudfwlrq%hwzhhq12&+$1*($wwulexwh0rghdqg$wwulexwh&rppdqgv confusion can arise from assuming that the nochange attribute mode prohibits changes to attributes under all circumstances. This is not the case. The purpose of nochange attribute mode is to prevent commands that indirectly call for at...
Page 328
D-14 ,qwhudfwlrq%hwzhhqwkh&rqfhdo$wwulexwhdqg&rppdqgvwkdw0rgli\ $wwulexwhv using the conceal attribute, entire sections of the display can be made to temporarily disappear. Later, the hidden portion of the display can be made to reappear with its original characters and associated attributes. A typi...
Page 329
D-15 (glwlqjd6wruhg6fuhhqzlwkwkh6hohfw6fuhhq&rppdqg the select screen command provides a convenient way for the host to select any screen for editing. Usually, the host selects the displayed screen in which case editing changes are visible as they are made. Sometimes the host may select a stored scr...
Page 330
D-16 0dsslqj&kdudfwhu)rqwv any of the four character fonts can be mapped into either the standard or extended character sets. This provides a method to rearrange the contents of the character sets or to display custom characters. The mapping between the character fonts and character sets can vary fr...
Page 331
D-17 ,qwhudfwlrq%hwzhhq3rzhu8s,qwhuuxsw0rghdqg0xowlgurs3urwrfro the power-up interrupt modes provides a means for the host to be notified automatically whenever the tcs regains power after an unexpected power loss. When power-up interrupt mode is set, the tcs automatically generates an interrupt to ...
Page 332
D-18 ,qwhudfwlrq%hwzhhq'hdg7rxfknh\vdqg7rxfk2shudwlrq the host can selectively disable touch reporting from touchkeys that do not correspond to touch targets by programming a touchkey type to be "dead." this simplifies touch report decoding for the host because the tcs does not generate any touch re...
Page 333
D-19 ,qfrqvlvwhqw&rppxqlfdwlrq6hwxs%hwzhhq+rvwdqg7&6 to make interfacing as trouble-free as possible, the tcs features easily configured communication parameters. This configurability takes some care to manage. Usually a report in the operational status window of the setup screen provides a tip if t...
Page 334: &2002123(5$725352%/(06
D-20 &2002123(5$725352%/(06 6dylqj'lvsod\$fwlylw\dv2)) saving the display activity parameter as off (in the setup screen) can be mistaken for tcs failure when the unit is next powered up or reset and there is no display activity. Anytime the display is unexplainably dark, and remains so after a brie...
Page 335: 23(5$7,21$/67$7865(32577$%/(
D-21 23(5$7,21$/67$7865(32577$%/( this table explains the reports that can be displayed in the operational status window of the setup screen. Also shown are the messages that can be communicated to the host via the request error status command or the error interrupt mode command. Note the term ’expa...
Page 336
D-22 &rppxqlfdwlrqviudplqjhuuru (6&!>!Q the tcs received a code from the host but did not detect a stop bit. The code is lost, and an fe character is printed in its place. The host interface may not be configured to the proper framing format (see communication commands). &rppxqlfdwlrqvryhuuxqhuuru (...
Page 337
D-23 ([sdqvlrqphpru\xqlqlwldol]hghuuru (6&!>!Q the tcs has encountered a nonvolatile expansion memory device that has never been programmed or is improperly programmed for the current configuration. An expansion memory uninitialized error can only occur during power-up or reset when the tcs reads th...