- DL manuals
- Gaggenau
- Dishwasher
- DF 280
- Operating Instructions Manual
Gaggenau DF 280 Operating Instructions Manual - page 49
49
Installation and connection en-us
Hot water connection *
Hot wate
r connect
ion
The dishwasher can be connected to cold or hot water
up to max. 140° F (60 °C). Connection to hot water is
recommended if the hot water can be supplied by
energetically favourable means and from a suitable
installation, e.g. solar heating system with circulation
line. This will save energy and time. The “Hot water”
setting allows you to adjust your dishwasher optimally to
operation with hot water. It is recommended to have a
water temperature (temperature of the incoming water)
of at least 104° F (40 °C) and no more than 140° F
(60 °C). It is not recommended to connect the
appliance to hot water if the water is supplied from an
electric boiler.
To change the setting:
1.
Open the door.
2.
Switch on ON/OFF switch (.
3.
Press Info button ( 8 for 3 seconds until the
following text is indicated on the display window at
the top @:
Scroll with < >
Set with - +
Leave with t 3 sec.
4.
Keep pressing the button > )* until water
connection appears of the display window at the
top @.
5.
Make the selection with setting buttons + -X.
6.
Press and hold the Info button (8 for 3 seconds.
The chosen setting has now been stored.
* optional feature which may or may not be included with
your dishwasher
Electrical connection
▯
Connect the appliance to an 120 V, 60 Hz alternating
current only, via a correctly installed outlet with
protective grounding conductor. See rating plate for
required fusing 9:.
▯
The outlet must be near the appliance and freely
accessible after the installation.
If the plug is not freely accessible, an allpole
disconnector with a contact opening of at least 3 mm
must be fitted on the installation side to satisfy the
relevant safety instructions.
▯
The connection may be modified by technicians only.
▯
A power cord extension may be purchased from
customer service only.
▯
Use only a residual current operated circuit-breaker
which features the symbol ‚. Only this extension
guarantees compliance with the currently valid
regulations.
▯
The appliance features a water damage protection
system. Please note the system will function only
when the power supply is connected.
Removing the appliance
Also observe the sequence of worksteps here.
1.
Disconnect the appliance from the power supply.
2.
Turn off the tap.
3.
Undo the drain water and water supply connection.
4.
Loosen fastening screws for the cabinet parts.
5.
If fitted, remove the base panel.
6.
Pull out the appliance, carefully pulling the hose
behind.
Transporting the appliance
Empty the dishwasher and secure loose parts.
Drain the appliance according to the following steps:
1.
Turn on the tap.
2.
Open the door.
3.
Switch on ON/OFF button (.
4.
Select wash cycle with the highest temperature.
The estimated wash cycle duration is indicated on
the digital display @.
5.
Press START button )".
6.
Close the door.
Wash cycle sequence starts.
7.
Open the door after approx. 4 minutes.
8.
Press START button )" until “Program was
terminated”/“Ready in one minute.” is indicated at
the digital display @.
9.
Close the door.
10.
Open the door after approx. 1 minute.
The digital display @ indicates; “Finished”.
Summary of DF 280
Page 1
*djjhqdx en-us operating instructions fr-ca notice d'utilisation dishwasher df 280 / 281.
Page 2
2.
Page 3: Table of Contents
3 en-us table of contents en-usoperating instructions 4 safety definitions 6 ( important safety instructions 7 risk of fire, electrical shock, or serious injury 7 grounding instructions 7 safe operation 8 child safety 8 proper care and maintenance 8 ( causes of damage 10 * getting started 11 applian...
Page 4
4 en-us 4 customer service 45 4 statement of limited product warranty 45 what this warranty covers & who it applies to 45 how long the warranty lasts 45 repair/replace as your exclusive remedy 46 out of warranty product 46 warranty exclusions 46 how to obtain warranty service 47 installation and con...
Page 5
5 en-us &rqjudwxodwlrqvdqg7kdqn 3krqh 0dlq6wuhhw6xlwh ,uylqh&$ 7kdqn\rxiruvhohfwlqjd*djjhqdxglvkzdvkhu 7klvpdqxdozdvzulwwhqzlwk\rxuvdihw\dqgfrqyhqlhqfhlqplqgdqgwkhlqirupdwlrqfrqwdlqhgkhuhlqlvyhu\lpsruwdqw 7rohduqhyhqpruhderxw\rxuglvkzdvkhudqgdydlodeohdffhvvrulhvdvzhoodvpdq\rwkhuwrstxdolw\ 3ohdvhfrqw...
Page 6
6 en-us safety definitions 4 safety definitions safety definitions 9 warning this indicates that death or serious injuries may occur as a result of non-observance of this warning. 9 caution! This indicates that minor or moderate injuries may occur as a result of non-observance of this warning. Notic...
Page 7
7 9 important safety instructions read and save these instructions ( important safety instructions this dishwasher is provided with installation instructions and this use and care manual. Read and understand all instructions before using the dishwasher. This dishwasher is intended for use up to a ma...
Page 8
9 important safety instructions read and save these instructions 8 safe operation use this dishwasher only for its intended function, which is the washing of household dishware and kitchenware rated as dishwasher safe. Use only detergents or rinsing agents recommended for use in a dishwasher, and ke...
Page 9
9 9 important safety instructions read and save these instructions notice: it is highly recommended for the end user to become familiar with the procedure to shut off the incoming water supply and the procedure to shut off the incoming power supply. See the installation instructions or contact your ...
Page 10
10 en-us causes of damage ( causes of damage causes of damage notices ▯ never use steam cleaning products to clean your dishwasher. The manufacturer will not be liable for the possible damages or consequences. ▯ to avoid possible dishwasher damage, do not use harsh chemicals, abrasive cleaners, scou...
Page 11
11 getting started en-us * getting started getting started appliance overview 67$57 uhvhwvhf vhf k plq uhvhwvhf vhf w.
Page 12
12 en-us getting started the numbers stated below refer to the overview images on the previous page of this manual. Operating panel **number of wash cycles and options varies on specific model number dishwasher interior components * optional feature which may or may not be included with your dishwas...
Page 13
13 getting started en-us switching on the appliance for the first time when the dishwasher is switched on for the first time, you are taken directly to the settings for switching on the appliance for the first time. The following text is indicated on the display window at the top @: scroll with set ...
Page 14
14 en-us getting started setting factory setting infotext by pressing info button ( time setting 12:00 set the current time. Time format 24h 12h or 24h. Time display time show end of wash cycle with display "finish in" or "finish at". Language american english language selection. Water hardness °e 0...
Page 15
15 water softening system / special salt en-us water softening system / special salt water softening system / special salt to ensure good rinsing results, the dishwasher requires soft water, i.E. Water which is low in lime, otherwise limescale will be deposited on the utensils and interior container...
Page 16
16 en-us rinse aid top off the salt as follows: 1. Undo the screw plug on the dispenser 1r. 2. Fill the dispenser with water (required only when switching on the appliance for the first time). 3. Add salt as illustrated (do not use table salt or tablets). The water is displaced and runs out. For mor...
Page 17
17 rinse aid en-us 3. Close the lid. Lid must be fully closed until it clicks in order to seal. 4. Wipe up any excess rinse aid that may have puddled when the dispenser reservoir is full. This prevents excessive frothing during the next wash cycle. Notice: do not fill the rinse aid dispenser 9" with...
Page 18
18 en-us loading the dishwasher - loading the dishwasher loading the dishwasher dishware material note: before using your dishwasher for the first time, check the information in this section. Some items are not dishwasher-safe and should be hand washed; others require special loading. Glass and silv...
Page 19
19 loading the dishwasher en-us loading the lower rack place large items in the lower rack 1j. Load pots, pans and bowls upside down. Do not block the vent hole with tall baking sheets. Load these items on the right side of the dishwasher. Recommended loading pattern note: folding the cup shelves do...
Page 20
20 en-us loading the dishwasher third rack - 10 place setting loading the silverware basket* place knives and sharp utensils with their handles up and forks and spoons with their handles down. If large or oddly-shaped items are loaded in the silverware basket, be sure they do not nest together. 9 wa...
Page 21
21 loading the dishwasher en-us depending on the features of your dishwasher, you can fold down the side shelves to provide more room for taller items of silverware. The front rows of prongs can be folded down to provide room for wider handles. * optional feature which may or may not be included wit...
Page 22
22 en-us loading the dishwasher plastic item clips* light-weight plastic accessories (cups, lids, etc.) can be held securely by the plastic item clips. Press the plastic item clip against the rack as shown until it clicks. * optional feature which may or may not be included with your dishwasher extr...
Page 23
23 loading the dishwasher en-us adjusting the height of the rack * adjustin g the he ight of the rack if required, the height of the upper rack 12 can be adjusted to create more space for taller utensils either in the upper or lower rack. Appliance height 32 in (81.5 cm) appliance height 35 in (86.5...
Page 24
24 en-us loading the dishwasher removing third rack 1*: 1. Pull out third rack all the way (1). 2. Lift front of the third rack out of the catch (2). 3. Pull out third rack forwards and lower (3). Installing third rack 1* 1. Pull out third rack rails all the way (1). 2. Insert third rack (2). In doi...
Page 25
25 loading the dishwasher en-us installing upper rack 12: 1. Pull out upper rack rails all the way (1). 2. Insert upper rack (2). In doing so, note the position of the detent pins (as illustrated in step 2). 3. Lift upper rack slightly and insert rear detent pins into the locking hooks (3). 4. Lower...
Page 26
26 en-us detergent . Detergent detergent use only detergent specifically designed for dishwashers. For best results, use fresh powdered dishwashing detergent or detergent tabs. Notice: to avoid dishwasher damage: ▯ do not use hand dishwashing products in your dishwasher. ▯ do not use too much deterg...
Page 27
27 detergent en-us combination detergent apart from conventional single function detergents, a number of products are offered with additional functions. These products contain not only the detergent but also rinse aid and salt replacement substances (3in1) and, depending on the combination (4in1, 5i...
Page 28
28 en-us dishwasher cycles / dishwasher cycles dishwasher cycles note: in order to save energy, it is recommended to set the auto power off feature to “after one minute”. Note: the energy guide label was based on the normal or regular soil sensing cycle as follows: the unit was tested without any ri...
Page 29
29 dishwasher cycle options en-us 0 dishwasher cycle options dishwasher cycle options intensive zone Ï intensiv e zone perfect for a mixed load. You can wash very soiled pots and pans in the lower rack together with normally soiled utensils in the upper rack. The spray pressure in the lower rack is ...
Page 30
30 en-us dishwasher cycle options note: only sanitizing cycles have been designed to meet the requirements of section 6 of the nsf/ansi standard for residential equipment for soil removal and sanitization efficacy. There is no intention, either directly or indirectly, to imply that all cycles have p...
Page 31
31 operating the dishwasher en-us 1 operating the dishwasher operating the dishwasher note: with hidden controls, the door must be opened before changing settings and closed after changing settings. 9 warning risk of injury! To avoid risk of injury, always use caution when opening the door during or...
Page 32
32 en-us operating the dishwasher time display the wash cycle time is determined during the wash cycle by the water temperature, the amount of dishes, as well as the degree of soiling and may vary (depending on the selected wash cycle). You can change the time display into time of day or hours/minut...
Page 33
33 operating the dishwasher en-us changing start wash cycle you can change the “start wash cycle” setting. Tone volume the end of the wash cycle is indicated by a buzzer. You can also change this setting. Button volume when you are operating the dishwasher, a signal sounds whenever a button is press...
Page 34
34 en-us operating the dishwasher switching off the appliance short time after the end of the wash cycle: 1. Open the door. 2. Switch off on/off button (. 3. Turn off tap. 4. Remove the utensils when they have cooled down. 9 warning risk of injury! To avoid risk of injury, always use caution when op...
Page 35
35 care and maintenance en-us 2 care and maintenance care and maintenance a regular inspection and maintenance of your machine will help to prevent faults. This saves time and prevents future problems. Overall condition of the dishwasher ▯ check rinsing compartment for grease and limescale deposits....
Page 36
36 en-us care and maintenance when washing normally attached food soils that have been scraped before loading, in a household that runs the dishwasher every other day, your filter should be cleaned: note: clean the filter after washing loads with large amounts of food soils or loads with a heavy sta...
Page 37
37 care and maintenance en-us drain pump large food remnants in the rinsing water not retained by the filters may block the waste water pump. In this case: 9 warning use caution when removing parts for cleaning as some debris may be sharp. 1. Disconnect the appliance from the power supply. 2. Take o...
Page 38
38 en-us troubleshooting 3 troubleshooting troubleshooting dishwashers may occasionally exhibit problems that are unrelated to a malfunction of the dishwasher itself. The following information may help you with a dishwasher problem without involving a repair professional. Note: if the appliance stop...
Page 39
39 troubleshooting en-us error code “:ƒ… is lit. Waste-water hose kinked or blocked. Install hose without kinks, remove any residue. Siphon connection still sealed. Check connection to siphon and open if required. Cover on the drain pump loose. Lock cover correctly. Error code “:ƒ† is lit. Drain pum...
Page 40
40 en-us troubleshooting silverware not dry. Silverware not arranged properly in the silverware basket. Separate silverware if possible, prevent contact points. Silverware not arranged properly in the third rack. Arrange silverware properly and separate if possible. Appliance interior wet after rins...
Page 41
41 troubleshooting en-us detergent residue. Detergent dispenser cover 9* blocked by dishes and therefore does not open fully. Dishes must not be placed above the detergent tab tray 1b. These may block the lid of the detergent dispenser and prevent it from opening fully. Do not place dishes or fragra...
Page 42
42 en-us troubleshooting tea or lipstick residue on the dishes. Too low rinsing temperature. Select wash cycle with higher washing temperature. Too little or unsuitable detergent. Use suitable detergent at correct dosage. Dishes precleaned too intensely; sensors therefore decide on weak wash cycle s...
Page 43
43 troubleshooting en-us rust spots on the silverware. Silverware not adequately rust- resistant. Knife blades are frequently more severely affected. Use corrosion-resistant silverware. Silverware will also rust if rusting parts are rinsed at the same time (pan handles, damaged utensil baskets, etc....
Page 44
44 en-us troubleshooting -------- door does not open. Door is not set correctly. Set the door correctly with the aid of the installation instructions. Child lock is activated. Press twice in quick succession at the top of the door in the middle. Appliance is disconnected from the mains. Check mains ...
Page 45
45 customer service en-us 4 customer service customer service your dishwasher requires no special care other than that described in the care and maintenance section of this manual. If you are having a problem with your dishwasher, before calling for service please refer to the troubleshooting guide ...
Page 46
46 en-us statement of limited product warranty repair/replace as your exclusive remedy during this warranty period, gaggenau or one of its authorized service providers will repair your product without charge to you (subject to certain limitations stated herein) if your product proves to have been ma...
Page 47
47 installation and connection en-us claim arises in contract or tort (including strict liability, or negligence) or otherwise. This warranty is in lieu of all other warranties, whether express or implied. Any warranty implied by law, whether for merchantability or fitness for a particular purpose, ...
Page 48
48 en-us installation and connection technical specifications ▯ weight: up to 132 lbs (60 kg) ▯ voltage: 120 v, 60 hz ▯ connected load: 1,300 w. ▯ circuit breaker: 12 a ▯ power input: off mode (po)* 0.50 w. Left on mode (pl)* 50 w. *according to regulations (eu) nos. 1016/2010 and 1059/2010. Additio...
Page 49
49 installation and connection en-us hot water connection * hot wate r connect ion the dishwasher can be connected to cold or hot water up to max. 140° f (60 °c). Connection to hot water is recommended if the hot water can be supplied by energetically favourable means and from a suitable installatio...
Page 50
50 en-us installation and connection 11. Switch off on/off switch (. 12. Turn off the tap, disconnect supply hose and drain water. Note: transport appliance upright only. This prevents residual water from running into the machine control and damaging the wash cycle sequence. Securing the appliance a...
Page 51: Table Des Matières
51 installation and connection fr-ca table des matières fr-canotice d'utilisation 4 indications de sécurité 54 ( consignes de sÉcuritÉ importantes 55 risque d'incendie, de choc électrique, ou de blessures graves 55 instructions de mise à la terre 55 fonctionnement normal 56 sécurité pour enfants 57 ...
Page 52
52 fr-ca installation and connection 4 service à la clientèle 96 4 déclaration de la garantie limitée du produit 96 ce que couvre cette garantie et à qui elle s'applique : 96 durée de la garantie 96 réparer/remplacer, comme recours exclusif 97 produit hors garantie 97 exclusions de garantie 97 comme...
Page 53
53 installation and connection fr-ca )polflwdwlrqvhwphuflgh*djjhqdx 3krqh 0dlq6wuhhw6xlwh ,uylqh&$ 0huflg·dyrlufkrlvlxqodyhydlvvhooh*djjhqdx9rxvuhmrljqh]ohvqrpeuhx[frqvrppdwhxuvtxlh[ljhqwxq &hjxlghdpwppfulwhqyxhghodvpfxulwphwgxf{wpsudwltxhhwo·lqirupdwlrqfrqwhqxhlflhvwwuqvlpsruwdqwh 3rxuhqfrqqdvwuhg·...
Page 54
54 fr-ca indications de sécurité 4 indications de sécurité indications de sécurité 9 avertissement ceci indique des risques de blessures graves ou mortelles en cas de non-respect de cette mise en garde. 9 attention ! Ceci indique des risques de blessures mineures ou de gravité moyenne en cas de non-...
Page 55
55 9 consignes de sÉcuritÉ importantes lisez et conservez ces instructions ( consignes de sÉcuritÉ importantes ce lave-vaisselle est livré avec des instructions de montage et ce manuel d'utilisation et d'entretien. Lisez et assurez-vous d'avoir bien assimilé toutes les instructions avant d'utiliser ...
Page 56
9 consignes de sÉcuritÉ importantes lisez et conservez ces instructions 56 9 avertissement risque de choc électrique ! Cet appareil doit être mis à la terre. En cas de dysfonctionnement, la mise à la terre réduira le risque de choc électrique en fournissant une voie de moindre résistance au courant ...
Page 57
57 9 consignes de sÉcuritÉ importantes lisez et conservez ces instructions sécurité pour enfants pour réduire le risque de blessure, interdisez aux enfants de jouer dans ou sur le lave- vaisselle. À l'âge adulte leur permettant d'utiliser la machine, les enfants sont sous la responsabilité de leurs ...
Page 58
58 fr-ca causes de pannes ( causes de pannes causes de pannes avis ▯ n'utilisez jamais de nettoyants à vapeur pour laver votre lave-vaisselle. Le fabricant n'est pas responsable des conséquences ou des dommages éventuels. ▯ pour éviter toute possibilité d'endommager le lave- vaisselle, n'utilisez pa...
Page 59
59 mise en route fr-ca * mise en marche mise en route vue d'ensemble de l'appareil 67$57 uhvhwvhf vhf k plq uhvhwvhf vhf w.
Page 60
60 fr-ca mise en route les numéros mentionnés ci-dessous font référence aux images d'aperçu sur la page précédente du présent manuel. Panneau de commande **le nombre de cycles de lavage et d'options dépend du numéro du modèle en question composants internes du lave-vaisselle * option facultative qui...
Page 61
61 mise en route fr-ca première mise sous tension de l'appareil lorsque le lave-vaisselle est mis sous tension pour la première fois, celui-ci vous invite à définir les paramètres requis après une première mise sous tension. Le message suivant est indiqué dans la fenêtre d'affichage supérieure @ : f...
Page 62
62 fr-ca mise en route paramètre réglages d'usine texte informatif en appuyant sur le bouton information ( réglage de l'heure 12:00 réglage de l'heure actuelle. Format d'affichage de l'heure. 24 h 12 h ou 24 h affichage de l'heure heure afficher l'heure de la fin du cycle via le message « fin dans »...
Page 63
63 système d'adoucissement de l'eau / sels fr-ca système d'adoucissement de l'eau / sels système d'adoucissement de l'eau / sels afin d'obtenir un bon rinçage, le lave-vaisselle a besoin d'une eau douce, c.-à-d. D'une eau pauvre en calcaire, à défaut de quoi des dépôts de calcaire se formeront sur l...
Page 64
64 fr-ca produit de rinçage remplissez les sels au maximum comme suit : 1. Retirez le bouchon à vis du distributeur 1r. 2. Remplissez le distributeur d'eau (opération requise uniquement lors de la première mise sous tension de l'appareil). 3. Ajoutez les sels tel qu'illustré (n'utilisez pas de sel d...
Page 65
65 produit de rinçage fr-ca 2. Ajoutez le produit de rinçage liquide au distributeur 9" jusqu'à pleine capacité. Ne le remplissez pas outre mesure. 3. Fermez le couvercle. Le couvercle doit être hermétiquement fermé jusqu'à l'encliquetage du loquet, pour garantir son étanchéité. 4. Essuyez tout excé...
Page 66
66 fr-ca chargement du lave-vaisselle - chargement du lave-vaisselle chargement du lave-vaisselle matériaux lavables au lave-vaisselle remarque : avant la première utilisation de votre lave- vaisselle, vérifiez les informations énoncées dans la présente rubrique. Certains objets ne peuvent pas être ...
Page 67
67 chargement du lave-vaisselle fr-ca ▯ lavez uniquement la vaisselle et les articles de cuisine indiqués comme lavables au lave-vaisselle. Reportez-vous à la rubrique matériaux lavables au lave-vaisselle pour plus d'informations sur la vaisselle adaptée. Avis : afin de ne pas endommager le lave-vai...
Page 68
68 fr-ca chargement du lave-vaisselle panier supérieur - 10 emplacements troisième panier - 10 emplacements chargement du panier à ustensiles* les couteaux et ustensiles tranchants doivent être placés avec les poignées en haut, les cuillères et fourchettes avec les poignées en bas. Si des objets vol...
Page 69
69 chargement du lave-vaisselle fr-ca accessoires de panier troisième panier* le troisième panier 1* permet de placer horizontalement les couteaux, spatules et autres outils de grande taille pour un meilleur nettoyage et un chargement et déchargement faciles. Disposez la coutellerie dans le troisièm...
Page 70
70 fr-ca chargement du lave-vaisselle rabattez les dents comme suit : 1. Tirez légèrement la dent rabattable vers vous et libérez-la de son encoche (1). 2. Poussez la dent rabattable vers le bas à la position désirée (2). Pour les élever, poussez les peignes rabattables dans une position verticale j...
Page 71
71 chargement du lave-vaisselle fr-ca pièce pour récipients gastro norm* pièce pou r récipi ents gast ro norm cette pièce vous permet d'empiler plusieurs récipients gastro norm ou ustensiles plats similaires selon un certain angle sur le panier inférieur. Vous pouvez retirer cette pièce au besoin. *...
Page 72
72 fr-ca chargement du lave-vaisselle disposez les plats et assiettes d'un diamètre compris entre 31 et 34 cm (12,2 po - 13,4 po) dans le panier inférieur 1j tel qu'illustré. * option facultative qui peut être ou ne pas être incluse avec votre lave-vaisselle panier supérieur avec leviers latéraux 1....
Page 73
73 chargement du lave-vaisselle fr-ca installez le troisième panier 1* 1. Sortez les glissières du troisième panier jusqu'au bout (1). 2. Insérez le troisième panier (2). Ce faisant, remarquez la position des crans (tel qu'illustré à l'étape 2). 3. Soulevez légèrement le troisième panier, puis insér...
Page 74
74 fr-ca chargement du lave-vaisselle 3. Soulevez légèrement le panier, supérieur, puis insérez les crans à l'arrière dans les crochets de verrouillage (3). 4. Abaissez le panier supérieur, puis appuyez sur l'encoche à l'avant (4). Le panier supérieur s'encliquette alors dans sa position. 5. Insérez...
Page 75
75 détergent fr-ca . Détergent détergent utilisez uniquement un détergent spécialement conçu pour les lave-vaisselle. Pour de meilleurs résultats, utilisez un détergent pour lave-vaisselle en poudre ou des comprimés détergents. Avis : pour éviter d'endommager le lave-vaisselle : ▯ évitez d'utiliser ...
Page 76
76 fr-ca détergent détergent multifonctionnels en plus des détergents conventionnels, il existe des produits multifonctionnels. Ces produits contiennent non seulement du détergent, mais aussi un agent de rinçage et des substances qui remplacent les sels (3 en 1), ou selon leur composition (4 en 1, 5...
Page 77
77 cycles du lave-vaisselle fr-ca / cycles du lave-vaisselle cycles du lave-vaisselle remarque : afin d'économiser de l'énergie, il est recommandé de régler l'option arrêt automatique sur « après 1 minute ». Remarque : l'étiquetage energy star se base sur le cycle de détection du niveau de saleté no...
Page 78
78 fr-ca options de cycles du lave-vaisselle 0 options de cycles du lave-vaisselle options de cycles du lave-vaisselle zone intensive Ï zone int ensive idéal pour un chargement mixte. Vous pouvez nettoyer les chaudrons et les poêles fortement souillés dans le panier inférieur avec des ustensiles sou...
Page 79
79 options de cycles du lave-vaisselle fr-ca remarque : seuls les cycles de désinfection ont été mis en place de manière à respecter les exigences de la section 6 de la norme nsf/ansi relative aux Équipements à usage résidentiel destinés à l'élimination de salissures et à la désinfection efficace. À...
Page 80
80 fr-ca mise en marche du lave-vaisselle 1 mise en marche du lave-vaisselle mise en marche du lave-vaisselle remarque : avec les fonctions masquées, la porte doit être ouverte avant le changement des réglages et fermée une fois ces réglages effectués. 9 avertissement risque de blessures ! Pour évit...
Page 81
81 mise en marche du lave-vaisselle fr-ca aquasensor * aquasensor l'aquasensor est un outil de mesure optique (à barrière de lumière) qui évalue la turbidité de l'eau de rinçage. L'aquasensor est utilisé en fonction du cycle de lavage. S'il est activé, l'eau de rinçage « propre » peut être réutilisé...
Page 82
82 fr-ca mise en marche du lave-vaisselle infolight * infolight durant le cycle de lavage, un point lumineux est projeté au sol, en face de l'appareil. N'ouvrez pas la porte de l'appareil avant que le point ait disparu. Si la porte de l'appareil n'est pas complètement fermée, le point lumineux clign...
Page 83
83 mise en marche du lave-vaisselle fr-ca fin du cycle de lavage *le cycle de nettoyage est terminé lorsque « terminé » apparaît sur l'affichage digital @. *si la projection au sol est activée, la fin du cycle de nettoyage est affichée au sol. * option facultative qui peut être ou ne pas être inclus...
Page 84
84 fr-ca entretien et maintenance 2 entretien et maintenance entretien et maintenance une inspection régulière et une maintenance de votre appareil vous aideront à prévenir d'éventuelles pannes. Ceci vous permet de sauver du temps et de parer à de nouveaux problèmes. État général du lave-vaisselle ▯...
Page 85
85 entretien et maintenance fr-ca selon les habitudes d'utilisation et la dureté de l'eau, le système de filtration nécessite un certain entretien afin de garder son efficacité. Vous pouvez nettoyer le système de filtration : ▯ lorsque vous y trouvez des résidus d'aliments ou si des éléments sont re...
Page 86
86 fr-ca entretien et maintenance 4. Nettoyez les bras de pulvérisation à l'eau claire. 5. Remontez les bras de pulvérisation. Pompe pour eaux résiduaires de gros résidus alimentaires présents dans l'eau de rinçage et non retenus par les filtres peuvent obstruer la pompe pour eaux résiduaires. Dans ...
Page 87
87 dépannage fr-ca 3 dépannage dépannage les lave-vaisselle peuvent occasionnellement présenter des problèmes sans rapport avec un dysfonctionnement dudit lave-vaisselle. Les informations suivantes peuvent vous aider à résoudre un problème afférent au lave- vaisselle sans la nécessité de recourir à ...
Page 88
88 fr-ca dépannage le code d'erreur “:‚ƒ est allumé. Résistance calcinée ou entartrée. Nettoyez l'appareil à aide d'un produit de nettoyage pour lave-vaisselle ou d'un détartrant. Utilisez le lave-vaisselle avec le système d'adoucissement de l'eau et vérifiez son réglage. Le code d'erreur “:ƒƒ est a...
Page 89
89 dépannage fr-ca la vaisselle n'est pas sèche. Distributeur d'agent de rinçage vide ou insuffisamment rempli. Remplissez l'agent de rinçage. Cycle de lavage sélectionné sans séchage. Sélectionnez un cycle de lavage avec séchage. Il reste de l'eau dans les creux de la vaisselle et de l'argenterie. ...
Page 90
90 fr-ca dépannage traces de nourriture sur la vaisselle. Pas assez d'espace entre les éléments, panier surchargé. Disposez la vaisselle de manière adéquate en laissant suffisamment d'espace entre les éléments afin que les jets d'eau puissent atteindre toute leur surface. Évitez les points de contac...
Page 91
91 dépannage fr-ca résidus de détergent. Le couvercle du distributeur 9*de détergent est bloqué par la vaisselle et ne peut pas s'ouvrir complètement. La vaisselle ne doit pas être placée au- dessus du compartiment détergent1b. Cela peut bloquer le couvercle du distributeur de détergent et l'empêche...
Page 92
92 fr-ca dépannage dépôts calcaires blancs et tenaces sur la vaisselle, les parois ou la porte. Dépôt de substances du détergent. Ces dépôts ne peuvent généralement pas être retirés à l'aide de produits chimiques (nettoyant pour lave- vaisselle, etc.). Changez de marque de détergent. Nettoyez l'appa...
Page 93
93 dépannage fr-ca taches amovibles sur les verres, verres et argenterie avec une apparence métallique. Trop d'agent de rinçage. Réglez la quantité d'agent de rinçage à une valeur moins élevée. Pas d'agent de rinçage ou valeur définie trop faible. Ajoutez de l'agent de rinçage et vérifiez le dosage ...
Page 94
94 fr-ca dépannage l'appareil ne se met pas en marche. Le fusible de réseau a peut-être brûlé ou le disjoncteur s'est peut-être déclenché. Vérifiez le fusible de réseau ou le disjoncteur. La porte peut ne pas être correctement verrouillée. Appuyez sur l'interrupteur d'alimentation principale pour la...
Page 95
95 dépannage fr-ca -------- la porte ne ferme pas. Le système de fermeture automatique de la porte n'est pas dans la position de départ. Après avoir ouvert la porte, attendez une seconde avant de pouvoir la fermer à nouveau. Le couvercle du distributeur de détergent ne peut être fermé. Le distribute...
Page 96
96 fr-ca service à la clientèle 4 service à la clientèle service à la clientèle votre lave-vaisselle ne nécessite pas d'entretien autre que les mesures décrites dans la rubrique entretien et maintenance du présent manuel. En cas de défaillance de votre lave-vaisselle, veuillez vous référer à la rubr...
Page 97
97 déclaration de la garantie limitée du produit fr-ca découlant des différences inhérentes aux pièces peintes et en porcelaine, ainsi que découlant des différences causées par l'éclairage de cuisine, l'emplacement du produit ou d'autres facteurs similaires. Cette garantie relative à l'apparence exc...
Page 98
98 fr-ca déclaration de la garantie limitée du produit ▯ les forces et facteurs externes, élémentaires et/ou environnementaux, y compris, mais sans limitation, la pluie, le vent, le sable, les inondations, les incendies, coulées de boue, températures de gel, moisissures excessives ou l'exposition pr...
Page 99
99 installation et raccordement fr-ca installation et raccordement installation et raccordement le lave-vaisselle doit être raccordé correctement sous peine de ne pas fonctionner convenablement. Les caractéristiques d'arrivée et d'écoulement d'eau, ainsi que la puissance raccordée doivent correspond...
Page 100
100 fr-ca installation et raccordement installation les dimensions requises pour l'installation se trouvent dans les instructions d'installation. Mettez l'appareil à niveau à l'aide des pieds ajustables. Assurez-vous que l'appareil est posé de manière sûre. ▯ un appareil encastré ou intégré par la s...
Page 101
101 installation et raccordement fr-ca ▯ la prise de courant doit se situer à proximité de l'appareil et être facilement accessible après installation. Si la prise n'est pas librement accessible, un commutateur omnipolaire avec une ouverture des contacts de 3 mm minimum doit être monté sur le côté d...
Page 104
*djjhqdx 0dlq6wuhhw6xlwh ,uylqh&$ 86$ 3krqh*$**(1$8 lqir#jdjjhqdxxvdfrp zzzjdjjhqdxxvdfrp *9001046140* 9001046140 (9509).